[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30765.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  217/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.4.1d.16.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->57 1sezA PDBj 2e-04 40.0 %
:RPS:PDB   7->369 3dmeA PDBj 1e-17 12.6 %
:RPS:SCOP  4->224 1an9A1  c.4.1.2 * 8e-18 16.2 %
:RPS:SCOP  216->299 1c0iA2  d.16.1.3 * 2e-05 18.3 %
:HMM:SCOP  1->285 1el5A1 c.3.1.2 * 2.8e-22 20.1 %
:RPS:PFM   5->367 PF01266 * DAO 2e-13 27.9 %
:HMM:PFM   5->367 PF01266 * DAO 2.2e-35 22.8 325/358  
:BLT:SWISS 5->397 MNMC_PSYIN 5e-34 28.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30765.1 GT:GENE ACD30765.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 873872..875077 GB:FROM 873872 GB:TO 875077 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30765.1 GB:DB_XREF GI:187712468 LENGTH 401 SQ:AASEQ MIKRIAIIGAGLAGCSLAYELSKSASFDITIFDKNSEVAGEASGNFAGILAPYLTFDNNFSDQFHTLGYRLLIDFINQYKNNVEICNQGVIQILSDPKEQCRYQKIFTNRDIDPNIAKLLSATQVSQLINTTNSKRAVYYPNALALVPKSICQLWLKLSDVELKLGNQLLNIQRTENNTWQLEFNNFKENFDIVIFAGGYPLFKQIVQLQKIPVYPSQGQLTVIEKSFDITKTIMDKGYIIPNYKQNLQVIGATFRDNGDTNADIREEDNNFNITQIKQMLDNSSILGINIVDSRVATRCVTSDHLPLVGKLVDYAKFEQDFYKPLSKGYPKAKMPRLEYQQDLYVSSGFGSKGLCSSLLAAKIIAAQITNQKLPHCDKLLAALAIERFWIRGFKKGIKFL GT:EXON 1|1-401:0| BL:SWS:NREP 1 BL:SWS:REP 5->397|MNMC_PSYIN|5e-34|28.0|382/690| TM:NTM 1 TM:REGION 5->27| BL:PDB:NREP 1 BL:PDB:REP 3->57|1sezA|2e-04|40.0|50/456| RP:PDB:NREP 1 RP:PDB:REP 7->369|3dmeA|1e-17|12.6|334/366| RP:PFM:NREP 1 RP:PFM:REP 5->367|PF01266|2e-13|27.9|319/354|DAO| HM:PFM:NREP 1 HM:PFM:REP 5->367|PF01266|2.2e-35|22.8|325/358|DAO| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01266|IPR006076| RP:SCP:NREP 2 RP:SCP:REP 4->224|1an9A1|8e-18|16.2|198/247|c.4.1.2| RP:SCP:REP 216->299|1c0iA2|2e-05|18.3|82/95|d.16.1.3| HM:SCP:REP 1->285|1el5A1|2.8e-22|20.1|268/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 217 OP:NHOMOORG 217 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------1--------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-1111111111111-111----------------------1-1-11----------1111--------------------------------11-11111111-----------1----111-11111111--11-11--1-1-11-11------1------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----1111--111111111111111111----------1111111111111111111111111111111111111111111----------------1-111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 390 STR:RPRED 97.3 SQ:SECSTR cccEEEEEcccHHHHHHHHHHHHHTTccEEEEcccccccccTTcccccEEcccccccTTcHHHHHHHHHHHHHHHHHHHTccEEccEccEEEEEccHHHHTTHHHHHHHHHHTTcccEEEEHHHHHHHcTTccccEEEEETTcEEEcHHHHHHHHHHHTTcEEEccccEEEEEEcTTccEEEEEcTTccEEEEEEEccGHHTEETccGGGccccEEEEEEEEEcccccccccEEEcccccEEEcTTccEEEccccEEEccccccccGGGGGGHHHHHHTTcTTccTTccEEEEEcccTTccccccEEEcHHHHcEccTTcTTccccccccccc##TTEEEcTTEEEEEcccTTHHHHHHHHHHHHHHHHHHcccccHHHccGGGcTTcGGGc######### DISOP:02AL 400-402| PSIPRED cccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccHHHHHHHHHHHHHccccccEEEEccHHHHHHHccccccccEEEEccccEEcHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEccEEEEEcEEEEcccccHHHHHHHHccccEEEEEEEEEEEEcccccccccccccEEEEEccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHccccccccccccccEEccccHHHHHHHHcccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHHHHccc //