[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30774.1
DDBJ      :             GTP-binding protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  359/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:290 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->268 1pujA PDBj 5e-36 37.2 %
:RPS:PDB   111->182 3a1tA PDBj 6e-10 26.8 %
:RPS:SCOP  8->268 1pujA  c.37.1.8 * 2e-26 34.7 %
:HMM:SCOP  8->182 1pujA_ c.37.1.8 * 4.9e-31 28.7 %
:HMM:SCOP  112->258 2cxxA1 c.37.1.8 * 7.4e-15 20.0 %
:RPS:PFM   115->172 PF02421 * FeoB_N 4e-04 40.4 %
:HMM:PFM   122->178 PF01926 * MMR_HSR1 5.1e-15 36.8 57/108  
:HMM:PFM   216->278 PF09553 * RE_Eco47II 0.00072 22.6 62/214  
:BLT:SWISS 2->268 RBGA_BACSU 7e-46 38.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30774.1 GT:GENE ACD30774.1 GT:PRODUCT GTP-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(891363..892235) GB:FROM 891363 GB:TO 892235 GB:DIRECTION - GB:PRODUCT GTP-binding protein GB:PROTEIN_ID ACD30774.1 GB:DB_XREF GI:187712477 LENGTH 290 SQ:AASEQ MLHWFPGHMHKATKEFRKKMPSINIAIEIVDARIPDSSSNHVLEQIVGDKPIIKVLSKNDLADTTITKQWLDYYKGSAIAVNTLEDKNIVKRILDLAQKKCPQRGTVLKPIRAIIFGLPNVGKSTMINKLAGRKVAKTGNEPAVTKLQQRIDISKTFMIFDTPGIMFPSPKSESSAFRIAAIGSIRDTAMDYEGTACYLLNFFREKYTKNFLARYNFISEKDFLERHPQEILKDISIAKTNSNLKQAAKNIVHDFRAGHFGKISLEDPQTIEAEKQQQILLEQQQLQQNL GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 2->268|RBGA_BACSU|7e-46|38.8|260/282| SEG 276->289|qqqilleqqqlqqn| BL:PDB:NREP 1 BL:PDB:REP 8->268|1pujA|5e-36|37.2|242/261| RP:PDB:NREP 1 RP:PDB:REP 111->182|3a1tA|6e-10|26.8|71/254| RP:PFM:NREP 1 RP:PFM:REP 115->172|PF02421|4e-04|40.4|57/188|FeoB_N| HM:PFM:NREP 2 HM:PFM:REP 122->178|PF01926|5.1e-15|36.8|57/108|MMR_HSR1| HM:PFM:REP 216->278|PF09553|0.00072|22.6|62/214|RE_Eco47II| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF02421|IPR011619| GO:PFM GO:0015093|"GO:ferrous iron transmembrane transporter activity"|PF02421|IPR011619| GO:PFM GO:0015684|"GO:ferrous iron transport"|PF02421|IPR011619| GO:PFM GO:0016021|"GO:integral to membrane"|PF02421|IPR011619| RP:SCP:NREP 1 RP:SCP:REP 8->268|1pujA|2e-26|34.7|245/261|c.37.1.8| HM:SCP:REP 8->182|1pujA_|4.9e-31|28.7|174/273|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 112->258|2cxxA1|7.4e-15|20.0|145/0|c.37.1.8|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 880 OP:NHOMOORG 580 OP:PATTERN --1111--111111111-11111------------11111111--------11-1111111---1--- -------------------------------------------------------------------------------------111----------------------------------------------------------1111111111111-11111111111111111111111--------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-11--1------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111111111111111111111---111--1---1--------1-1---111-----1-----------------------------11-1111-1111111111111111111111--------------------------------------------------------------------------------------------------------------1-11----------------------111-1-----------------111111111111111111111111------------------------11111111--111111-11111111111111111111111111111--- --11122-633133312222223131-2223332221333333233333333232311233332313212322332312223332321-112211122-12-13231352356232321-24223313-7M5-5331-113222--111241-33323347222433323535431122E2221234533231221221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 90.0 SQ:SECSTR #######cTTcTTHHHHHHHTTccEEEEEEETTcTTTTccTTcccccHHHHHHHHHTccHHHHHHccHHHHHHHHHHHHHHHHTcccHHHHHHHHTccccccccccccccEEEEEEccTTccHHHHHHHHHTTccEEEEEcTTcccEEEEEEETEEEEEEEcccccccccccHHHHHHHHHHHHHHTETTcHHHHHTHHHHHHHHHHEcTTcTTTccccHHHHHHHHHHTTcEEEEETTTTccHHHHHHHHHHTcHHHHTcccccccT###################### PSIPRED cccccHHHHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHccccEEEEEEcHHcccHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHccccEEEcccccccEEEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHHccc //