[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30776.1
DDBJ      :             glycoprotease family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  501/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:212 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->156 2gelA PDBj 6e-17 32.0 %
:RPS:PDB   2->155 2a6aA PDBj 2e-23 25.5 %
:RPS:SCOP  4->101 1okjA1  c.55.1.9 * 6e-24 34.7 %
:RPS:SCOP  107->162 1okjA2  c.55.1.9 * 6e-06 30.4 %
:HMM:SCOP  2->107 1okjA1 c.55.1.9 * 1.5e-25 35.8 %
:RPS:PFM   32->106 PF00814 * Peptidase_M22 1e-10 36.0 %
:HMM:PFM   31->162 PF00814 * Peptidase_M22 1.4e-26 29.0 131/268  
:BLT:SWISS 1->167 Y388_HAEIN 7e-21 35.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30776.1 GT:GENE ACD30776.1 GT:PRODUCT glycoprotease family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 893435..894073 GB:FROM 893435 GB:TO 894073 GB:DIRECTION + GB:PRODUCT glycoprotease family protein GB:PROTEIN_ID ACD30776.1 GB:DB_XREF GI:187712479 LENGTH 212 SQ:AASEQ MNFLLLDTSSKYCSVVLSAAGELYNDTREIPRQHNKYLLEMIHGVFAKAAVNIKDLDFIAYGVGPGSFVGVRLAAAVCQGFAVGLDIPVIGFSSMFALAKSVTTESQKVAVILDAKMDDFYLGLYDKDTDQIITENVYKLEEYSQDLYAGYQLVGESIAELQLKNDDFKIDVANVVEYVYKQYQKQKYDGTLTQETFPVYLRGTSHWQAKKE GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 1->167|Y388_HAEIN|7e-21|35.0|157/236| SEG 175->188|vveyvykqyqkqky| BL:PDB:NREP 1 BL:PDB:REP 1->156|2gelA|6e-17|32.0|153/218| RP:PDB:NREP 1 RP:PDB:REP 2->155|2a6aA|2e-23|25.5|149/191| RP:PFM:NREP 1 RP:PFM:REP 32->106|PF00814|1e-10|36.0|75/260|Peptidase_M22| HM:PFM:NREP 1 HM:PFM:REP 31->162|PF00814|1.4e-26|29.0|131/268|Peptidase_M22| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00814|IPR000905| GO:PFM GO:0006508|"GO:proteolysis"|PF00814|IPR000905| RP:SCP:NREP 2 RP:SCP:REP 4->101|1okjA1|6e-24|34.7|98/106|c.55.1.9| RP:SCP:REP 107->162|1okjA2|6e-06|30.4|56/110|c.55.1.9| HM:SCP:REP 2->107|1okjA1|1.5e-25|35.8|106/0|c.55.1.9|1/1|Actin-like ATPase domain| OP:NHOMO 502 OP:NHOMOORG 502 OP:PATTERN -------------------------------------------------------------------- --1---1------1----------------------------------1-----------------------------1-1------------1111--1-111111--1--------------11-1-----1--------------------------------------------------1-------1-111111111111111------111111-1-1111111---11111111111111-1111-1-1--1--11111111111--111111111111--1111111111111111111111-1---111---11111111111111111111111111111111-111-1-111-11111-1----1---11111-111111---11111111111111-------1-11--111-11-111--1---1-11-----1-------------------111------------------------------11111111111-----1111-----1111---111--1--11111-11--11111111111111111111-1111-----------111-111-1------1--------------------------111111111111111111111111111111111-1111111----111111-1111111111-111111111111111111111111111-111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-------------1------1-------------------------1---1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 73.6 SQ:SECSTR cEEEEEEccccEEEEEEEETTEEEEEEEcccGGGGGHHHHHHHHHHHHHTccGGGccEEEEEcccccHHHHHHHHHHHHHHHGGGTccEEEEcHHHHHHTccccEccEEEEEEEccTTEEEEEEEEEcEEEEEEHHHEcHHHHHHHHcccEEEEcc######################################################## PSIPRED cEEEEEEcccHHHEEEEEEccEEEEEEEEccHHHHHHHHHHHHHHHHHccccHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccccEEEEEEcccccEEEEEEccccccccccccccHHHHHHHcccccEEEEccHHHHccccccccccHHHHHHHHHHHHHHcccccccHHHcccEEcccccccHHHcc //