[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30777.1
DDBJ      :             glutamine amidotransferase class-II family protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  148/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:268 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   35->148 1te5A PDBj 7e-07 31.4 %
:RPS:PDB   42->176 2bplA PDBj 2e-15 21.1 %
:RPS:SCOP  34->194 1te5A  d.153.1.1 * 2e-22 24.3 %
:HMM:SCOP  2->267 1ecfA2 d.153.1.1 * 1.1e-29 23.5 %
:HMM:PFM   75->128 PF00310 * GATase_2 1e-09 32.0 50/362  
:HMM:PFM   209->255 PF01660 * Vmethyltransf 0.00092 25.5 47/308  
:BLT:SWISS 1->161 YNT1_YEAST 7e-31 46.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30777.1 GT:GENE ACD30777.1 GT:PRODUCT glutamine amidotransferase class-II family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 894077..894883 GB:FROM 894077 GB:TO 894883 GB:DIRECTION + GB:PRODUCT glutamine amidotransferase class-II family protein GB:PROTEIN_ID ACD30777.1 GB:DB_XREF GI:187712480 LENGTH 268 SQ:AASEQ MCRWLMYHGDKIKMSDLLVDPENSLIHQSIHSSQGAVPVNGDGFGVGWYTSLHKEPGVYKDPLPAWNNQNLISLAKHIKSRNFMAHVRASTIAPTSRVNCHPFTFKNHLFMHNGSIAGFDDIRQEIEQLVKPQYFKARFGSTDSEAIFLLAVSNGLENDPKLAIVKSIEQITKIQAKNGLKESIKASIAYSNGEISYSLKISTIGNEPSLYYISYKDIIETLDLKKKNKFKNGFVVLSEPLVKSDSYSYVNNYTCIEIRQNEFKVEKL GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 1->161|YNT1_YEAST|7e-31|46.0|161/357| SEG 224->237|lkkknkfkngfvvl| BL:PDB:NREP 1 BL:PDB:REP 35->148|1te5A|7e-07|31.4|102/253| RP:PDB:NREP 1 RP:PDB:REP 42->176|2bplA|2e-15|21.1|128/608| HM:PFM:NREP 2 HM:PFM:REP 75->128|PF00310|1e-09|32.0|50/362|GATase_2| HM:PFM:REP 209->255|PF01660|0.00092|25.5|47/308|Vmethyltransf| RP:SCP:NREP 1 RP:SCP:REP 34->194|1te5A|2e-22|24.3|148/253|d.153.1.1| HM:SCP:REP 2->267|1ecfA2|1.1e-29|23.5|226/0|d.153.1.1|1/1|N-terminal nucleophile aminohydrolases (Ntn hydrolases)| OP:NHOMO 283 OP:NHOMOORG 249 OP:PATTERN ---------------------------------1--------------------1------------- ----2------------11-11--1-111111----1223-1-2--------1-------11--1-1121------------1-------------------------1-------------------------------------1-1111------------1111121-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------11111-11111-22122122-1--1111111111111-----111111-11--------------1--------------------------------1-------11111111111111111111111111111--11----------------------------------------------------------2112-----------------------------------------------1------2------------1--------------------------------------------------------------------------------------------------22121---1--------------------------1-----------------111111111-----11111--111------------------------------------------------------------------------- ----111--------22221111111111111111111111111111111111111111-11111111-11111111-11111111---142211-1111121111--4------------------------------------------------------------------1-1111111-----2--1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 74.3 SQ:SECSTR EEEEcTTcccHHHHHHHHHHHHHHHHHHHHHHTccccEEcccEEEEEEEcTTccEcEEEEEEEccHHHHHHHHHHccccccEEEEEEEccccccccGGGcccEEETTEEEEEEEccTTHHHHHHHHHHTHHTccccccTcccHHHHHHHHHHHHHTTccHHHHHHHHGGGccccEEHHHHHHHHHHHcccccccEEEEE##################################################################### PSIPRED ccEEEEEEccHHHHHHHHHcccHHHHHHHHccccccccccccccEEEEEccccccEEEEEccccccccHHHHHHHHHccccEEEEEEcccccccccHHHcccEEEccEEEEEccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEcccccccccEEEEEcccccEEEcHHHccccccEEEEEEccccccccEEEccccEEEEEEccEEEEEEc //