[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30791.1
DDBJ      :             conserved protein of unknown function
Swiss-Prot:Y1151_FRATT  RecName: Full=UPF0350 protein FTT1151c;

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.218.1
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->83 2jr5A PDBj 3e-09 34.8 %
:RPS:SCOP  15->82 1puzA  a.218.1.1 * 7e-08 26.5 %
:HMM:SCOP  5->86 1puzA_ a.218.1.1 * 4.3e-15 30.5 %
:RPS:PFM   21->65 PF03937 * Sdh5 7e-06 48.8 %
:HMM:PFM   18->66 PF03937 * Sdh5 1.6e-17 36.7 49/51  
:BLT:SWISS 1->95 Y1151_FRATT 3e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30791.1 GT:GENE ACD30791.1 GT:PRODUCT conserved protein of unknown function GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 908860..909147 GB:FROM 908860 GB:TO 909147 GB:DIRECTION + GB:PRODUCT conserved protein of unknown function GB:PROTEIN_ID ACD30791.1 GB:DB_XREF GI:187712494 LENGTH 95 SQ:AASEQ MLIKNNDLIFSSVDKIKYSARRGMLELDIILAPYLNNCYMHEDLANKKLFVEFLTSEDSDMFDWLFKGVTPPQRYQQLIDKIIKEKKKFNQTKLK GT:EXON 1|1-95:0| SW:ID Y1151_FRATT SW:DE RecName: Full=UPF0350 protein FTT1151c; SW:GN OrderedLocusNames=FTT1151c; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|Y1151_FRATT|3e-52|100.0|95/95| BL:PDB:NREP 1 BL:PDB:REP 15->83|2jr5A|3e-09|34.8|69/94| RP:PFM:NREP 1 RP:PFM:REP 21->65|PF03937|7e-06|48.8|43/51|Sdh5| HM:PFM:NREP 1 HM:PFM:REP 18->66|PF03937|1.6e-17|36.7|49/51|Sdh5| RP:SCP:NREP 1 RP:SCP:REP 15->82|1puzA|7e-08|26.5|68/82|a.218.1.1| HM:SCP:REP 5->86|1puzA_|4.3e-15|30.5|82/82|a.218.1.1|1/1|YgfY-like| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----------------------111111111-1-1------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 77.9 SQ:SECSTR ##############HHHHHHccccHHHHHTTTTHHHHHTTTccHHHHHHHHHHHTcccHHHHHHHHccccccHHHHHHHHHHHHHHHH####### PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcc //