[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30793.1
DDBJ      :             amino acid-polyamine-organocation (APC) superfamily
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  144/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:502 amino acids
:PSIPRED
:RPS:PFM   63->339 PF00324 * AA_permease 1e-05 25.1 %
:HMM:PFM   22->476 PF00324 * AA_permease 2.3e-20 23.3 404/479  
:BLT:SWISS 8->393 YBEC_BACSU 3e-57 32.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30793.1 GT:GENE ACD30793.1 GT:PRODUCT amino acid-polyamine-organocation (APC) superfamily GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 913388..914896 GB:FROM 913388 GB:TO 914896 GB:DIRECTION + GB:PRODUCT amino acid-polyamine-organocation (APC) superfamily GB:PROTEIN_ID ACD30793.1 GB:DB_XREF GI:187712496 LENGTH 502 SQ:AASEQ MSNNVSVKKMSLFSAILIGTTCMVGAGWLFSAQLTAKNAGNWAFLAWILAALIVVMIALCLGKVVSLYPVRGATTRSSAISHNSIFAMPFAFANWFGIVVVISSEALATTQYLSGVKSMQWLMSDGVLTTAGTAFALFVLFVYLVINFYGVKVLAKVNNAITVFKMAVPFIVVIIFITYAFMHSSDHVSMFSEDIPNNSQFGFSSALTAIVAGGLIYTFNGFQTVVAYASEVKNPGRNIPLAIILALLIVLVLYLGLQYAFMQAVPHQYLLDKGGWAGLNFDSPLLQVATLLGLGYISFLLIVDSVISPSATGYTYLGASSRMLYAMSSEGQMPRYFAKITPIVNISRRSLLANFILSVIFLFFSDNWTGLMLVVTGFHIIGYMAAPVSMGALAPRTRLFGLVVFVVLTLLLNTVEIQTQINMSVILIVLMTIYASLEFRRIGIKNLLMLILPFIIFVCLITPITNYFADAIVGVIFYWFVTDKRYVAFCRSTANEKNIIVD GT:EXON 1|1-502:0| BL:SWS:NREP 1 BL:SWS:REP 8->393|YBEC_BACSU|3e-57|32.3|378/539| TM:NTM 12 TM:REGION 10->32| TM:REGION 42->64| TM:REGION 83->105| TM:REGION 131->153| TM:REGION 162->184| TM:REGION 198->220| TM:REGION 237->259| TM:REGION 288->310| TM:REGION 370->392| TM:REGION 398->420| TM:REGION 442->464| TM:REGION 470->492| SEG 43->61|aflawilaalivvmialcl| SEG 239->257|iplaiilallivlvlylgl| SEG 399->415|lfglvvfvvltlllntv| RP:PFM:NREP 1 RP:PFM:REP 63->339|PF00324|1e-05|25.1|263/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 22->476|PF00324|2.3e-20|23.3|404/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 252 OP:NHOMOORG 160 OP:PATTERN ------222222213--2-------------------------------------------356---- ---21-------1----------------------------1----------------------------------------1---------------------------------------------------------------------------1-111---------------1-----------12-2-------1--1---1--1112----------111111---1111111111111111111-11--1-11-1--11111-1-1-----------------------------------------------------1111111----------------------------------1-----------------------------------------------------------------1---------------------111-1-------------------------------------------222222122212212222212311------111------------------1----------------------1------------------------------------------------33---------------------------------------------------------------------------------1---11-----------------1-------------------------434431221--------------------11111-----------1111-111-----434326323-----------------22222222--------------------------------------------------------------- -----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccc //