[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30796.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  81/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.239.1
:84 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->66 1sg7A PDBj 2e-17 52.3 %
:RPS:SCOP  2->69 1sg7A1  a.239.1.1 * 7e-19 50.0 %
:HMM:SCOP  2->76 1sg7A1 a.239.1.1 * 1.1e-20 42.7 %
:RPS:PFM   9->68 PF06150 * ChaB 5e-09 62.0 %
:HMM:PFM   9->63 PF06150 * ChaB 4.4e-22 60.0 45/57  
:BLT:SWISS 1->66 CHAB_SHIFL 1e-17 53.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30796.1 GT:GENE ACD30796.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(918397..918651) GB:FROM 918397 GB:TO 918651 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACD30796.1 GB:DB_XREF GI:187712499 LENGTH 84 SQ:AASEQ MPYNKLAELPKRVKNVLPYHAQEIYQAAFNNAWKEYRDKSKRRTNDNLETIAHEVAWSAVKKNIIKMSKQENGVKSNIKMIMKF GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 1->66|CHAB_SHIFL|1e-17|53.0|66/76| BL:PDB:NREP 1 BL:PDB:REP 2->66|1sg7A|2e-17|52.3|65/75| RP:PFM:NREP 1 RP:PFM:REP 9->68|PF06150|5e-09|62.0|50/57|ChaB| HM:PFM:NREP 1 HM:PFM:REP 9->63|PF06150|4.4e-22|60.0|45/57|ChaB| RP:SCP:NREP 1 RP:SCP:REP 2->69|1sg7A1|7e-19|50.0|68/75|a.239.1.1| HM:SCP:REP 2->76|1sg7A1|1.1e-20|42.7|75/0|a.239.1.1|1/1|ChaB-like| OP:NHOMO 85 OP:NHOMOORG 85 OP:PATTERN ----------------------------------------------1-----1--------------- ----------------------------------------------------------------------------------1-------------1----------------------------------------------------1-------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------111--1---1-------------------------------------------------------------------------------1------------------------------------------------------------------1---1------------------------1---------11---1-1111111-11-1111111111111111111111-----111-1111111111-1-11111111----------------1-----------1-----------------------------------------------111111111--------------------------------------------------------------------------------------- -----1-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 77.4 SQ:SECSTR #cccccTTccHHHHTTcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHEEE################## PSIPRED cccccHHHccHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcc //