[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30808.1
DDBJ      :             glycosyl transferase family 8 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  136/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:296 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->260 1ss9A PDBj 2e-15 25.4 %
:RPS:SCOP  6->282 1g9rA  c.68.1.4 * 3e-47 24.0 %
:HMM:SCOP  4->284 1ga8A_ c.68.1.4 * 3e-53 29.5 %
:RPS:PFM   11->260 PF01501 * Glyco_transf_8 1e-14 31.8 %
:HMM:PFM   5->261 PF01501 * Glyco_transf_8 2.8e-44 26.1 234/242  
:BLT:SWISS 6->268 Y258_HAEIN 1e-16 28.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30808.1 GT:GENE ACD30808.1 GT:PRODUCT glycosyl transferase family 8 protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(940117..941007) GB:FROM 940117 GB:TO 941007 GB:DIRECTION - GB:PRODUCT glycosyl transferase family 8 protein GB:PROTEIN_ID ACD30808.1 GB:DB_XREF GI:187712511 LENGTH 296 SQ:AASEQ MNKIPIVFTFDKNIILGGAVTIKSLIDHANPDTCYDIYVYHPNINKKSISAFNSMIEKTKHSISFHNVDESIFKDVPIDTRRGWIITFYRLLIPKLLPQYDKVIYSDVDVLFQSDMSEVYNTDLTSYEWAGVIAEKHQQNMVQHKYFKENNNSYIYWPGFMVMNTKLMRENNFISRCFDTMHEFNTRLKFRDLDVLNLTCRKIKSLPFKYVTLQSIYYLNTIQEAPEYIFLKEIYSDNELLDAKNNPAIIHYAGSPGKPWRMKRPYKNYLEYISKIPKELRKYTFRDIKKKLLSKY GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 6->268|Y258_HAEIN|1e-16|28.9|242/330| BL:PDB:NREP 1 BL:PDB:REP 6->260|1ss9A|2e-15|25.4|244/280| RP:PFM:NREP 1 RP:PFM:REP 11->260|PF01501|1e-14|31.8|220/244|Glyco_transf_8| HM:PFM:NREP 1 HM:PFM:REP 5->261|PF01501|2.8e-44|26.1|234/242|Glyco_transf_8| GO:PFM:NREP 1 GO:PFM GO:0016757|"GO:transferase activity, transferring glycosyl groups"|PF01501|IPR002495| RP:SCP:NREP 1 RP:SCP:REP 6->282|1g9rA|3e-47|24.0|263/278|c.68.1.4| HM:SCP:REP 4->284|1ga8A_|3e-53|29.5|275/282|c.68.1.4|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 168 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------2--2---------121--------1-----------------------------1---1----------------11------------------1--------------------------------------1-11-1---111----------1---------------------12-1111-223--11113-1----1-111-----111--1--11-1---------------11---111------------------11------1---1---11------------------------------------------------------------------------------------------------------------------------1----1--1------------------------------------------------------------------------1----------------------1-------1--------------------11-2-3333233--------------------------------------------------2-----1-111-11111-11-12-111111111-11---11----1112111111111121-1111111--------------------------------------1212----1------------------------------11111111---------------------------------------------------------------------------------------3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 83.1 SQ:SECSTR #####EEEEEcGGGHHHHHHHHHH#HHHTcTTcccEEEEEEccccHHHHHHHHHTcGGGTTTEEEEEccGGGGTTcccccTTccGGGGGGGGHHHHccccccEEEEcTTEEEccccHHHHTcccTT#ccEEEEEcHHHHTcTTcGGGTccTTcccEEEEEEEEcHHHHTTccHHHHHHHHHHHcTTTcccTHHHHHHHHHT######HTTcEEEccGGGcccHHHHHHHTcccccccHHHHHHcccccEEEccc#cccTT#################################### PSIPRED ccEEEEEEEEcHHHHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHccEEEEEEccHHHHcccccccccccHHHHHHHHHHHHHccccEEEEEEccEEEcccHHHHHcccccccEEEEEEccccccHHHHccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccHHHccccccccccccccccccHHHcccccccccHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //