[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30819.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:HMM:PFM   33->92 PF06730 * DUF1208 0.00028 23.3 60/219  
:BLT:SWISS 9->77 VF259_IIV3 8e-05 41.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30819.1 GT:GENE ACD30819.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 957547..957888 GB:FROM 957547 GB:TO 957888 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30819.1 GB:DB_XREF GI:187712522 LENGTH 113 SQ:AASEQ MKNIPISYLTLLSRQINSAISDGYIESYSFEDIYNAIDNKNLEKIVTNEVADFGILSTIQKDELEWLYQQLAYEAKKFSDAGNERAKLGLDNKKHGLSLLLGMILEIIQSHYN GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 9->77|VF259_IIV3|8e-05|41.9|62/100| HM:PFM:NREP 1 HM:PFM:REP 33->92|PF06730|0.00028|23.3|60/219|DUF1208| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--1-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccHHHHHHHHHHHHHHHHHHHcc //