[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30823.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   66->110 PF10955 * DUF2757 8.3e-05 20.5 44/76  
:HMM:PFM   8->79 PF06480 * FtsH_ext 0.00083 12.5 72/110  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30823.1 GT:GENE ACD30823.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 963920..964318 GB:FROM 963920 GB:TO 964318 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30823.1 GB:DB_XREF GI:187712526 LENGTH 132 SQ:AASEQ MGRFQQNLMYAVILVIIFAVCVYFFTSNNEAETKGVYLPKYSAELPPTDPSQVRVYNLQYQSDTQRNIGQVRTSTHVSNEKDFQKLCDKNLKEAIKLAAQHGAHEIKYICLYPEGQINELSSVQLRGYAFRD GT:EXON 1|1-132:0| TM:NTM 1 TM:REGION 5->26| HM:PFM:NREP 2 HM:PFM:REP 66->110|PF10955|8.3e-05|20.5|44/76|DUF2757| HM:PFM:REP 8->79|PF06480|0.00083|12.5|72/110|FtsH_ext| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 132-133| PSIPRED cccHHHHHHHHHHHHHHHHHHEEEEEccccccccEEEccccccccccccccEEEEEEEEEccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEEEEcc //