[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30836.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->94 PF00910 * RNA_helicase 0.00056 20.8 72/107  
:BLT:SWISS 44->141 YMC0_YEAST 9e-04 26.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30836.1 GT:GENE ACD30836.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 978442..978867 GB:FROM 978442 GB:TO 978867 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30836.1 GB:DB_XREF GI:187712539 LENGTH 141 SQ:AASEQ MSFASQIEEIFGVDIWELKPQYKTSQQNQTTNDAQQQNEIITADLNDLELIYTNEITSSKIINILISTKLNLTFLKNIANSLFFNSKVSIYKSNDISSFEKLGGINLNEKDLFTNNIDLLSIQNKKYILSKLYKYADFSSR GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 44->141|YMC0_YEAST|9e-04|26.6|94/100| SEG 24->38|tsqqnqttndaqqqn| HM:PFM:NREP 1 HM:PFM:REP 22->94|PF00910|0.00056|20.8|72/107|RNA_helicase| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-39,87-87,90-90,95-95,109-109,123-123| PSIPRED ccHHHHHHHHHcccEEEEcccccccccccccHHHHHcccEEEEEcccEEEEEEcccccHHEEEEEEEcccHHHHHHHHHHHHEEccEEEEEEccccHHHHHHccccccHHHcccccEEEEEEccHHHHHHHHHHHHccccc //