[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30838.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->38 PF01028 * Topoisom_I 0.00026 18.9 37/235  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30838.1 GT:GENE ACD30838.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 981726..981890 GB:FROM 981726 GB:TO 981890 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30838.1 GB:DB_XREF GI:187712541 LENGTH 54 SQ:AASEQ MNEMKIKAASVCNDSKTIKKTWQTPMLSTQHQESESIEGKAPAGNEQFGTQGLS GT:EXON 1|1-54:0| HM:PFM:NREP 1 HM:PFM:REP 2->38|PF01028|0.00026|18.9|37/235|Topoisom_I| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--11---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,25-25,39-39| PSIPRED ccccEEEHHHHcccHHHHHHHHccccHHHHHHHHHccccccccccHHHHHcccc //