[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30839.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:207 amino acids
:PSIPRED
:RPS:PFM   122->175 PF04193 * PQ-loop 4e-04 38.9 %
:HMM:PFM   5->62 PF04193 * PQ-loop 7.4e-08 25.9 58/61  
:HMM:PFM   120->176 PF04193 * PQ-loop 1.6e-13 36.8 57/61  
:BLT:SWISS 49->139 CPT1_YEAST 4e-04 34.5 %
:BLT:SWISS 123->170 RTC2_YEAST 6e-06 39.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30839.1 GT:GENE ACD30839.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 986432..987055 GB:FROM 986432 GB:TO 987055 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30839.1 GB:DB_XREF GI:187712542 LENGTH 207 SQ:AASEQ MENFGYITLNISLIIYFIIFLPQTIHNQFKHKTFEISLWTHSLMIIANSLDLIYAIGFNMQWQYILVDIILLSFLTIQQLQILNDRREKYLFIHTISIFLYLFLVIVMIYFTSLSNQILLWFGSISGVIYNLYWLPQIYKNYRQKQAEGFSIFYLVLSLISIICDINSAIFLGWPLVSVIVSSCLSILVLTQIIQYFYYKSSFIKVI GT:EXON 1|1-207:0| BL:SWS:NREP 2 BL:SWS:REP 49->139|CPT1_YEAST|4e-04|34.5|84/393| BL:SWS:REP 123->170|RTC2_YEAST|6e-06|39.6|48/296| TM:NTM 6 TM:REGION 4->26| TM:REGION 38->59| TM:REGION 62->83| TM:REGION 98->120| TM:REGION 150->172| TM:REGION 175->197| SEG 176->190|lvsvivssclsilvl| RP:PFM:NREP 1 RP:PFM:REP 122->175|PF04193|4e-04|38.9|54/61|PQ-loop| HM:PFM:NREP 2 HM:PFM:REP 5->62|PF04193|7.4e-08|25.9|58/61|PQ-loop| HM:PFM:REP 120->176|PF04193|1.6e-13|36.8|57/61|PQ-loop| OP:NHOMO 19 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------322222222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEc //