[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30840.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   63->110 3cgwA PDBj 8e-04 10.6 %
:HMM:PFM   72->128 PF01346 * FKBP_N 1.3e-06 25.0 52/124  
:BLT:SWISS 4->81 COBS_PICTO 4e-04 28.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30840.1 GT:GENE ACD30840.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 987136..987567 GB:FROM 987136 GB:TO 987567 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30840.1 GB:DB_XREF GI:187712543 LENGTH 143 SQ:AASEQ MKSINKLILLIGALAFSISAFAVEQTSYNAYTIGQALGKVSHKSFAAMDQELVKKDFILGFDDTLLEHKPDIRKISDKDSYEVGMIIAAQYKVRLKKMIAVNEANCQEFVKGFNEGVDTKDTKLTIQDKEILKHFKISREEDN GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 4->81|COBS_PICTO|4e-04|28.2|78/100| TM:NTM 1 TM:REGION 4->26| RP:PDB:NREP 1 RP:PDB:REP 63->110|3cgwA|8e-04|10.6|47/295| HM:PFM:NREP 1 HM:PFM:REP 72->128|PF01346|1.3e-06|25.0|52/124|FKBP_N| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 47 STR:RPRED 32.9 SQ:SECSTR ##############################################################cccccc#TTcTTTTTTccccHHHHHHcTTTEEEEEEcccccccHHHHH################################# DISOP:02AL 143-144| PSIPRED ccHHHHHHHHHHHHHHHHHHHEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccEEEEEEEEEHHHHHHHHHHHHcHHHHHHHHHHHHccccccccEEEEcHHHHHHHHcccccccc //