[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30843.1
DDBJ      :             predicted ATPase of the PP-loop superfamily
Swiss-Prot:TTCA_FRATM   RecName: Full=tRNA 2-thiocytidine biosynthesis protein ttcA;

Homologs  Archaea  43/68 : Bacteria  471/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:267 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   14->198 1wy5A PDBj 3e-06 22.2 %
:RPS:PDB   23->267 2dplB PDBj 1e-27 12.8 %
:RPS:SCOP  12->230 1wy5A1  c.26.2.5 * 3e-27 17.9 %
:HMM:SCOP  22->254 1ni5A1 c.26.2.5 * 1.7e-52 29.7 %
:RPS:PFM   36->203 PF01171 * ATP_bind_3 7e-21 36.9 %
:HMM:PFM   36->201 PF01171 * ATP_bind_3 9.6e-19 26.9 160/182  
:HMM:PFM   9->49 PF06918 * DUF1280 5.8e-05 22.0 41/224  
:BLT:SWISS 1->267 TTCA_FRATM e-150 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30843.1 GT:GENE ACD30843.1 GT:PRODUCT predicted ATPase of the PP-loop superfamily GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(989478..990281) GB:FROM 989478 GB:TO 990281 GB:DIRECTION - GB:PRODUCT predicted ATPase of the PP-loop superfamily GB:PROTEIN_ID ACD30843.1 GB:DB_XREF GI:187712546 LENGTH 267 SQ:AASEQ MTNNTDKQTLKKLERQILRKTAQAINQYNMIEDGDKIMVCLSGGKDSYCLLEMLLLLQKKAPISFEIIAVNLDQKQPGFPEEVLPNYLKNKGVEFHIIERDTYSIVKRVIPEGKTTCGLCSRMRRGILYDFAEENNVTKVALGHHRDDIIETFFLNLFYNGSIKAMPAKLLSDDKRNIVIRPLAFVSEKETLEYSQLKEFPIIPCNLCGSQDNLQRVFIKDMLNRWEQNNPERKNVIFKALSNISPSQMLDKELFDFINISKDDIQR GT:EXON 1|1-267:0| SW:ID TTCA_FRATM SW:DE RecName: Full=tRNA 2-thiocytidine biosynthesis protein ttcA; SW:GN Name=ttcA; OrderedLocusNames=FTM_0908; SW:KW ATP-binding; Complete proteome; Cytoplasm; Nucleotide-binding;tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->267|TTCA_FRATM|e-150|100.0|267/267| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 50->57|llemllll| BL:PDB:NREP 1 BL:PDB:REP 14->198|1wy5A|3e-06|22.2|176/311| RP:PDB:NREP 1 RP:PDB:REP 23->267|2dplB|1e-27|12.8|242/278| RP:PFM:NREP 1 RP:PFM:REP 36->203|PF01171|7e-21|36.9|160/185|ATP_bind_3| HM:PFM:NREP 2 HM:PFM:REP 36->201|PF01171|9.6e-19|26.9|160/182|ATP_bind_3| HM:PFM:REP 9->49|PF06918|5.8e-05|22.0|41/224|DUF1280| RP:SCP:NREP 1 RP:SCP:REP 12->230|1wy5A1|3e-27|17.9|212/216|c.26.2.5| HM:SCP:REP 22->254|1ni5A1|1.7e-52|29.7|222/0|c.26.2.5|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 635 OP:NHOMOORG 558 OP:PATTERN 112-1211------11111-11-11------1222---2111-1-1--11111-1121222-1-1211 --1----------------------------------------------------------------------------------1111111-1------------1---111111111111111---------------------1--1---------------------------------11111211-----------------------------------1111---------------------------------------------------------------------------------------------221-233333332331211222222222-32-2--1111211-1122-12-1-----111-1-------------11111111111---------11--111111111111--11-1-11111111---------------------------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111112111-11111111111111121111111111111111111111111111111111111111211111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1111111111111111111111111-1111111111111111111111111111111112221222221111111111111111111111111111111----------------1--------------------1-------2-11-1------ ---1112--1-1-1-------------------111---------------------------------------------------------1-11---------1-112--------------------------------------------------1-211--11111111---611--11113--1211-112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 98.1 SQ:SECSTR #####cHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHHHHHHGGGEEEEEEEcccccTTHHHHHHHHHTTTcccEEEEEEHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHTccEEEcccccEEEcTTTTccHHHHHHHHTccHHHHTccccGGGGGccccccHHHHHHHHHHHHHHHHHTTccccEEEEEEcccccccccccTTcccEEEEEEEEEEcccccEEEccccHHHHHHHHHHHHH PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccHHHcccccccccccEEEEEccccccHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHccc //