[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30852.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  85/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.54
:94 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->94 1rwuA PDBj 4e-07 30.8 %
:RPS:SCOP  6->94 2h9zA1  d.58.54.2 * 2e-23 15.3 %
:HMM:SCOP  6->94 1rwuA_ d.58.54.1 * 7.6e-23 37.9 %
:RPS:PFM   10->94 PF04359 * DUF493 9e-13 37.3 %
:HMM:PFM   6->94 PF04359 * DUF493 6.9e-31 39.3 89/90  
:BLT:SWISS 8->94 Y3095_CHRVO 2e-17 42.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30852.1 GT:GENE ACD30852.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1003376..1003660) GB:FROM 1003376 GB:TO 1003660 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30852.1 GB:DB_XREF GI:187712555 LENGTH 94 SQ:AASEQ MSESNNHNQQETFFEFPCQFPIKIMANPQKETVEFILSVFEKYIPNHSEIDFNTKESKTGKYISITAIFTADSKEQLDNIYKEISAHPEVHMVL GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 8->94|Y3095_CHRVO|2e-17|42.5|87/89| BL:PDB:NREP 1 BL:PDB:REP 15->94|1rwuA|4e-07|30.8|78/87| RP:PFM:NREP 1 RP:PFM:REP 10->94|PF04359|9e-13|37.3|83/87|DUF493| HM:PFM:NREP 1 HM:PFM:REP 6->94|PF04359|6.9e-31|39.3|89/90|DUF493| RP:SCP:NREP 1 RP:SCP:REP 6->94|2h9zA1|2e-23|15.3|85/86|d.58.54.2| HM:SCP:REP 6->94|1rwuA_|7.6e-23|37.9|87/0|d.58.54.1|1/1|YbeD-like| OP:NHOMO 85 OP:NHOMOORG 85 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111-11111111-1111111111-11111111111111111111111-1111111---------------------------------------------------------------11----------------------------1-1--------------------------------------------------------------------------------------------------11-1---------------------------------------------1---1111111111--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 83.0 SQ:SECSTR ##############cccccEEEEEEEEccTTHHHHHHHHHHHHccc##cccEEEEEcccccEEEEEEEEccccHHHHHHHHHHHccccccEEEc PSIPRED cccccccHHcccHHccccccEEEEEEcccccHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEEEEccHHHHHHHHHHHHccccEEEEc //