[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30856.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids
:PSIPRED
:RPS:PFM   16->203 PF06835 * DUF1239 1e-05 26.2 %
:HMM:PFM   16->206 PF06835 * DUF1239 1.5e-49 27.2 173/176  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30856.1 GT:GENE ACD30856.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1006352..1006978 GB:FROM 1006352 GB:TO 1006978 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30856.1 GB:DB_XREF GI:187712559 LENGTH 208 SQ:AASEQ MKFFTKYSLFANVLSIIVIIFSMLYISYNALDGGKPLKNIPQKNRVELKAFDFNYNKYDSSGNLAMSFFAKELQRYLNQDLYMTDITEKSYDKATEKLNWQVQAKHAQQLANQNLIHLYDGVNAIMITKKSADNTQKTYDNDSTPDKIYIKSSEMFYNSSSKDFYNNRFTKMYDPKTGNNTTGTGVKGNSETKIIELSQNVRSYYATS GT:EXON 1|1-208:0| TM:NTM 1 TM:REGION 9->31| SEG 176->189|ktgnnttgtgvkgn| RP:PFM:NREP 1 RP:PFM:REP 16->203|PF06835|1e-05|26.2|164/170|DUF1239| HM:PFM:NREP 1 HM:PFM:REP 16->206|PF06835|1.5e-49|27.2|173/176|DUF1239| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccEEEEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccEEEHHHHHHHHccccEEEEccccEEEEEEcccccccccccccccccEEEEEcccEEEcccccHHHcccHHEEEccccccccccccccccccEEEEEEHHHHHHHHccc //