[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30858.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:243 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   6->226 2it1B PDBj 1e-34 34.6 %
:RPS:PDB   6->229 3b5jA PDBj 2e-39 20.3 %
:RPS:SCOP  6->242 1b0uA  c.37.1.12 * 4e-42 24.5 %
:HMM:SCOP  2->243 1g6hA_ c.37.1.12 * 1.3e-64 36.4 %
:RPS:PFM   45->166 PF00005 * ABC_tran 7e-15 38.1 %
:HMM:PFM   45->168 PF00005 * ABC_tran 2.6e-22 31.0 116/118  
:HMM:PFM   217->238 PF12399 * BCA_ABC_TP_C 7e-10 54.5 22/23  
:BLT:SWISS 6->243 LPTB_HAEIN 3e-89 65.1 %
:PROS 140->154|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30858.1 GT:GENE ACD30858.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1007869..1008600 GB:FROM 1007869 GB:TO 1008600 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:PROTEIN_ID ACD30858.1 GB:DB_XREF GI:187712561 LENGTH 243 SQ:AASEQ MERYTLEAKRLGKKYGSRWVVNNVSMKVLTGEIVGLLGPNGAGKTTSFYMIVGLVAATRGKVRMGQEDVTKMPIHLRARRGLGYLPQEASVFRKLSVEDNIVAILETRKDLNKIQIEEKLNELLDEFSIQHIRKSLGISLSGGERRRVEIARALAMDPKFILLDEPFAGVDPVSVIEIKEVVRHLKDRGIGVLITDHNVRETLDICERAYIVNAGNMLAAGTPEEVLADETVRKVYLGEDFKL GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 6->243|LPTB_HAEIN|3e-89|65.1|238/241| PROS 140->154|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 6->226|2it1B|1e-34|34.6|217/361| RP:PDB:NREP 1 RP:PDB:REP 6->229|3b5jA|2e-39|20.3|222/243| RP:PFM:NREP 1 RP:PFM:REP 45->166|PF00005|7e-15|38.1|118/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 45->168|PF00005|2.6e-22|31.0|116/118|ABC_tran| HM:PFM:REP 217->238|PF12399|7e-10|54.5|22/23|BCA_ABC_TP_C| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 6->242|1b0uA|4e-42|24.5|237/258|c.37.1.12| HM:SCP:REP 2->243|1g6hA_|1.3e-64|36.4|242/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52505 OP:NHOMOORG 1174 OP:PATTERN VVPCUOMNYYYUZTbSrKYSPTRa*QUhoYhaLDFEGEJIJHFVaRZkNT**j9SiSWZQVOMGc17B Uc*P*effmmpZfVaUXQP-PnDDc*QQQQQS*souz***a*h*q**iytjQ***SUmHJz**j*x****gaWWW*cbcQ*lmCCCACWVUQ7SHML1-IKTMOOhPdTT8999999BBACCCCJUTNRZSMUWeUqyy**NMM*d*ov*llrfoXaOMPLSJjnen***gMTKNLKLSJNLKndgYUrkAZk*************************luy**pv****z***elmnknkjlklllljehcfi*kgh**gQiam**QR**gbTdnllkmvtyusozzzzuwsurquxruwdcdcbdcfgedcb*npfefrpsqr***********m*ny***hool*yiz**nuTN**wnehirUcmeruRageOhZSSKLPOMPdV***ZVu****************-qy*oh*r***UE**************JLN**********YXYYYYYY*dhKRnc*8887877766789ADE89AB99AAB88A6MECGDF************************t********BP**y*rzpu******ctrLZMTiYKLJJKJJSRRdqmg**Xeb*mYkyeenLheeWUanXccbbcv*c*MNOTHLLLNKHBBDEEDFDDJRHHMRPooxSzYgJVLzQTWXUOVeWUVUVXcaWbY7-HKVOO221111*y**X*z********z*-*****z*******xy*yxw*****loeqpnooqqqqqooqoop*tnqvvvxS4************34JHFIFFGRSUSTM*r*YZZZaXHRTPNTOSdPRSRRIWJPUxhxwxvx***x****o***GGFDEHGEGOjpo*ttuut*****RPROOPOOPOHFEF99SWSSMNOO9989A899*DbBBB6A-ADFBIHCOOMAFKBEE999dq*YZo*opmFfP 2155ppH-fMADRdTMEGDHQROQISKHHCC8CNIIGIFECGGFDCGGLQQMYMJMKCBHFGDCI7D829B6ACDAF2BFBECDDK56-ET9EFEFFCCCC8FRKJATgopPYXkZiJJHFLUMupDyD**k4pUxLLFCeILmXCMGHEcHB*GZUTtLj*UsVfD*di*jejQHMGC*DGEJQ*cg*H*yPO*v**a ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 243-244| PSIPRED cccEEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHcHHHEEEEccccccc //