[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30865.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.269.1
:111 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   3->107 3cryB PDBj 5e-09 18.8 %
:RPS:SCOP  4->107 1xhsA  d.269.1.1 * 1e-09 20.7 %
:HMM:SCOP  2->107 1xhsA_ d.269.1.1 * 3.3e-06 31.5 %
:HMM:PFM   4->108 PF06094 * AIG2 5.6e-18 30.5 95/104  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30865.1 GT:GENE ACD30865.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1017049..1017384 GB:FROM 1017049 GB:TO 1017384 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30865.1 GB:DB_XREF GI:187712568 LENGTH 111 SQ:AASEQ MELLFSYGTLQQEEVQLSVFGRKLVGQKDSLKGYIVSEVEILDQRVIKVSGKKYHPILKKTENILDEVHGTVFELTTNEIKLSDKYEVDSYVRKKVTLNSGNSAWIYTEAV GT:EXON 1|1-111:0| RP:PDB:NREP 1 RP:PDB:REP 3->107|3cryB|5e-09|18.8|101/169| HM:PFM:NREP 1 HM:PFM:REP 4->108|PF06094|5.6e-18|30.5|95/104|AIG2| RP:SCP:NREP 1 RP:SCP:REP 4->107|1xhsA|1e-09|20.7|87/113|d.269.1.1| HM:SCP:REP 2->107|1xhsA_|3.3e-06|31.5|89/0|d.269.1.1|1/1|BtrG-like| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ----1---------1------------------------------1-------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------1----11------11111111-----------------------------1---------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 91.0 SQ:SECSTR ##EEEEccGGGcHHHHHHHcTTcEEEEEEEEEEE####EEEEEEETTcccTTTcccEEEEEEEEEEEEEEEEEEEEGGGHHHHHHHTTTccEEEEEEEccEEEEEEE#### PSIPRED cccEEccccccccHHHHHHHHHHHcccHHHcccEEEEEEEEccHHHHHHcccccccEEEEccccccccccEEEEEcHHHHHHHHcccccEEEEEEEEEEcccEEEEEEEcc //