[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30867.1
DDBJ      :             CBS domain pair protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:196 amino acids
:PSIPRED
:RPS:SCOP  33->156 2v8qE1  d.37.1.1 * 4e-05 10.3 %
:HMM:PFM   48->89 PF00571 * CBS 5.7e-06 23.8 42/57  
:HMM:PFM   131->174 PF00571 * CBS 7.1e-06 15.0 40/57  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30867.1 GT:GENE ACD30867.1 GT:PRODUCT CBS domain pair protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1018044..1018634) GB:FROM 1018044 GB:TO 1018634 GB:DIRECTION - GB:PRODUCT CBS domain pair protein GB:PROTEIN_ID ACD30867.1 GB:DB_XREF GI:187712570 LENGTH 196 SQ:AASEQ MDLKEFKKIELSHFKDAKSVNYLRDDVNHLLYLDSPALDVFRDYKEHDALVVKADVNLKDVKTKLIDNHKDFILVTDGEDKVIGSIALHYIQSQALNERARSSGTKPADLIANDIMLPIAKANVVSFSIIENSKIGHVVNTLINSDYHHIIVYDKDKNGEKYIRGYFSLPYIRRKLSLDVYHVYQKQGISNLNRGI GT:EXON 1|1-196:0| HM:PFM:NREP 2 HM:PFM:REP 48->89|PF00571|5.7e-06|23.8|42/57|CBS| HM:PFM:REP 131->174|PF00571|7.1e-06|15.0|40/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 33->156|2v8qE1|4e-05|10.3|117/145|d.37.1.1| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------11-1---------------------------------------------------------11---1--1-1--------11------11--1---1--1---------------------------------------------------------------------------------------------111-1--------1--------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHccccccHHHccccHHHHHHHHHHcccccEEEEEcccccccEEEEEEEHHHHHHHHcccHHHHHHHHHHHHHHHcc //