[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30872.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  189/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:67 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   1->63 2b5aB PDBj 8e-07 21.0 %
:RPS:SCOP  19->63 2ofyA1  a.35.1.3 * 7e-09 22.2 %
:HMM:SCOP  1->63 2a6cA1 a.35.1.13 * 4.2e-09 23.8 %
:HMM:PFM   9->61 PF01381 * HTH_3 1.4e-08 19.2 52/55  
:BLT:SWISS 1->67 YOZG_BACSU 1e-18 61.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30872.1 GT:GENE ACD30872.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1021862..1022065) GB:FROM 1021862 GB:TO 1022065 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:PROTEIN_ID ACD30872.1 GB:DB_XREF GI:187712575 LENGTH 67 SQ:AASEQ MAIKIDLAKIMLDKQIKSKDLARAIGITEQNLSILKNGKAKAIRFSTLEAICKYLECQPGDILVYKS GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|YOZG_BACSU|1e-18|61.2|67/100| RP:PDB:NREP 1 RP:PDB:REP 1->63|2b5aB|8e-07|21.0|62/75| HM:PFM:NREP 1 HM:PFM:REP 9->61|PF01381|1.4e-08|19.2|52/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 19->63|2ofyA1|7e-09|22.2|45/82|a.35.1.3| HM:SCP:REP 1->63|2a6cA1|4.2e-09|23.8|63/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 231 OP:NHOMOORG 190 OP:PATTERN ---------------------------------------------1---------------------- -1--2--1111---------------------------------11---11--21------1--1-111------111--31------1111-------1-1-1-2-----------------------------------------------------------------------------1--------1-1111121121212211-11-111211121-1111111-1---------------------11------1-11----1-----------1---1--------------------------211--1111--2111212222212111341---1--1---1--221---------1-------2331-------------1-111-------------1----------------------1121211-----1------------------------------------------------11-----------111---------111-111--1-------------1----------------------------1-------11-------1----------------------------------------11----1------1--21-1------1-12---------------11----------------------------------1--111-----------------1------------------------1-1---1112--------------------------------221211-----------11111111111111-------1--11-----------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHTccccccHHHHHHHHHHTTccHHHHHHcTc PSIPRED ccEEHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccc //