[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30874.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.50.1
:305 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  37->133 1nsoA  b.50.1.1 * 8e-04 12.9 %
:HMM:SCOP  37->136 1idaA_ b.50.1.1 * 0.0001 23.1 %
:HMM:PFM   37->133 PF00077 * RVP 0.00027 21.1 90/100  
:HMM:PFM   178->228 PF00077 * RVP 3e-05 22.0 50/100  
:BLT:SWISS 21->213 YMP8_YEAST 4e-04 27.3 %
:PROS 193->204|PS00141|ASP_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30874.1 GT:GENE ACD30874.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1022776..1023693 GB:FROM 1022776 GB:TO 1023693 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30874.1 GB:DB_XREF GI:187712577 LENGTH 305 SQ:AASEQ MFTYIGLCYAKQLPEILKKYNYQQLKLVDTNQEFVAPYLIAKVNQNKAYILFDSGSKGVSIFNSSVLNKRQDSNYSLNMAGQKSKNHSVILDEIEIGNIHLNNIKARTTTQPKKKQYPIIVIGLDFLEKYNAIFDFSRSYIYLTNRTITPKDHYLIGQKLQNNGNYLLINLTKLISQYQIMPITVNNNSPVNCLVDTGTSNFTISNNYSESLGLKSTSKKTIQATDGTLTIADANISSLIINPLNIFFQKKVKLDNISATSANIEPMSKFLGVLCVLGYKELSRMNSIYDIAAARIYIRNNHKRL GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 21->213|YMP8_YEAST|4e-04|27.3|161/514| PROS 193->204|PS00141|ASP_PROTEASE|PDOC00128| SEG 235->246|nissliinplni| SEG 288->299|iydiaaariyir| HM:PFM:NREP 2 HM:PFM:REP 37->133|PF00077|0.00027|21.1|90/100|RVP| HM:PFM:REP 178->228|PF00077|3e-05|22.0|50/100|RVP| RP:SCP:NREP 1 RP:SCP:REP 37->133|1nsoA|8e-04|12.9|93/107|b.50.1.1| HM:SCP:REP 37->136|1idaA_|0.0001|23.1|91/99|b.50.1.1|1/2|Acid proteases| OP:NHOMO 12 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1221111-2---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,31-31,34-34,39-39,53-53,59-70,73-74| PSIPRED ccEEEEEHHHHHHHHHHHHcccEEEEEEEccccccccEEEEEEcccEEEEEEEcccccEEEEcHHHHcccccccEEEEEcccccccccEEEEEEEEccEEEccEEEEEEcccccccccEEEEEHHHHHHHHHHEEEcccEEEEEcccccccccEEEEHHHcccccEEEEEHHHHHHccEEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccEEEEcccEEEEEccccEEEEEcHHHEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEcccccc //