[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30881.1
DDBJ      :             zinc (Zn2+)-iron (Fe2+) permease (ZIP) family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
:248 amino acids
:PSIPRED
:RPS:PFM   8->243 PF02535 * Zip 8e-11 30.9 %
:HMM:PFM   6->96 PF02535 * Zip 1.5e-11 22.0 91/319  
:HMM:PFM   98->245 PF02535 * Zip 1.3e-21 27.0 148/319  
:BLT:SWISS 10->247 ZIP11_ARATH 7e-17 31.5 %
:TM
:REPEAT 2|1->82|163->241

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30881.1 GT:GENE ACD30881.1 GT:PRODUCT zinc (Zn2+)-iron (Fe2+) permease (ZIP) family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1032851..1033597 GB:FROM 1032851 GB:TO 1033597 GB:DIRECTION + GB:PRODUCT zinc (Zn2+)-iron (Fe2+) permease (ZIP) family protein GB:PROTEIN_ID ACD30881.1 GB:DB_XREF GI:187712584 LENGTH 248 SQ:AASEQ MSNFQLTILLVILFVTAISGIFPFVKKANNPNGFHFPIGEALASGVFLGAGLIHMLGDSAGDFSELNIDYPFPFLIAGITILLFLLLEHIGGSLSKSNKGNLSFMATMATMMLSIHSFFEGAALGLSEELSVALVIFLAIVAHKWAASFALAININKTCMNFISRFMLFTIFVIMTPLGIVFGQAAQNYVTNPYVEPTFTAIAAGTFIYMGTLHGLDRSVLVKDCCNTKQYSSVIIGFTIMAIVAIWT GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 10->247|ZIP11_ARATH|7e-17|31.5|235/326| TM:NTM 5 TM:REGION 4->25| TM:REGION 71->93| TM:REGION 132->154| TM:REGION 163->185| TM:REGION 227->248| NREPEAT 1 REPEAT 2|1->82|163->241| RP:PFM:NREP 1 RP:PFM:REP 8->243|PF02535|8e-11|30.9|236/299|Zip| HM:PFM:NREP 2 HM:PFM:REP 6->96|PF02535|1.5e-11|22.0|91/319|Zip| HM:PFM:REP 98->245|PF02535|1.3e-21|27.0|148/319|Zip| GO:PFM:NREP 4 GO:PFM GO:0016020|"GO:membrane"|PF02535|IPR003689| GO:PFM GO:0030001|"GO:metal ion transport"|PF02535|IPR003689| GO:PFM GO:0046873|"GO:metal ion transmembrane transporter activity"|PF02535|IPR003689| GO:PFM GO:0055085|"GO:transmembrane transport"|PF02535|IPR003689| OP:NHOMO 64 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------111111111-------------------------------------------------1-111111----------------------------------------------------------------------------------------- 2-1122-------------------------------------------------------------------------------------------------------26-1-----------------2------------1--11---------111--1-12----321---1----1-1-2----1----121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHc //