[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30887.1
DDBJ      :             rare lipoprotein B family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->172 2jxpA PDBj 4e-04 22.2 %
:RPS:PDB   20->173 3bf2A PDBj 1e-13 17.6 %
:RPS:PFM   23->173 PF04390 * RplB 3e-11 28.7 %
:HMM:PFM   23->173 PF04390 * RplB 1.7e-22 23.8 143/147  
:BLT:SWISS 8->188 LPTE_ERWCT 1e-04 21.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30887.1 GT:GENE ACD30887.1 GT:PRODUCT rare lipoprotein B family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1041786..1042361) GB:FROM 1041786 GB:TO 1042361 GB:DIRECTION - GB:PRODUCT rare lipoprotein B family protein GB:PROTEIN_ID ACD30887.1 GB:DB_XREF GI:187712590 LENGTH 191 SQ:AASEQ MMKVRYIHTIFLFILSVVLLASCGFHPRGVLSDGNAGNFDSLVGTKVYIKADNFANFANALKRNLTNYNAIVVNDEKSADYIINIQDVKQESQLTSIVGGASNNTFQLIYTVTYNVVKPDDKTPVIPNRSINAQQFWQSNSGTQLAQNNEANRIYSYLEGQLVNNMATQIAALLPSKNTTQASTSSDNSLQ GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 8->188|LPTE_ERWCT|1e-04|21.1|171/184| TM:NTM 1 TM:REGION 5->27| BL:PDB:NREP 1 BL:PDB:REP 37->172|2jxpA|4e-04|22.2|135/155| RP:PDB:NREP 1 RP:PDB:REP 20->173|3bf2A|1e-13|17.6|119/122| RP:PFM:NREP 1 RP:PFM:REP 23->173|PF04390|3e-11|28.7|143/147|RplB| HM:PFM:NREP 1 HM:PFM:REP 23->173|PF04390|1.7e-22|23.8|143/147|RplB| GO:PFM:NREP 2 GO:PFM GO:0016044|"GO:cellular membrane organization"|PF04390|IPR007485| GO:PFM GO:0043165|"GO:Gram-negative-bacterium-type cell outer membrane assembly"|PF04390|IPR007485| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 78.5 SQ:SECSTR ###################ccccEEEEEc####cHHHHHHHHcccHHHHHTTcccHHHHHHHHHHHHcccEEEcccTTccEEEEEEEEEEEEEEcccccccEEccEEEEEEEEEEEEETTEEcccEcccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTT################## DISOP:02AL 190-192| PSIPRED ccEEEHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHcccccccHHHHHHHHHHHHcccEEEcccccccEEEEEEEccccEEEEEEEcccEEEEEEEEEEEEEEEEEccccEEEccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc //