[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30891.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y963_FRATM   RecName: Full=UPF0301 protein FTM_0963;

Homologs  Archaea  0/68 : Bacteria  438/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.310.1
:194 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->185 2gzoA PDBj 7e-28 33.9 %
:RPS:PDB   1->177 2do8A PDBj 5e-51 25.7 %
:RPS:SCOP  4->179 2aj2A1  d.310.1.1 * 2e-47 33.5 %
:HMM:SCOP  1->188 2do8A1 d.310.1.1 * 7e-47 33.3 %
:RPS:PFM   19->173 PF02622 * DUF179 6e-27 39.9 %
:HMM:PFM   18->177 PF02622 * DUF179 2.4e-45 36.8 155/161  
:BLT:SWISS 1->194 Y963_FRATM e-115 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30891.1 GT:GENE ACD30891.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1048014..1048598) GB:FROM 1048014 GB:TO 1048598 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30891.1 GB:DB_XREF GI:187712594 LENGTH 194 SQ:AASEQ MYQNHKNEILLATPLIKDDIVFTKSVVYLCQNDRHGAMGLIINKPLADTLKDVFEELHIPHTNTFKEILEYPLYMGGPISPHKIMILHTTNGRNYTSTIKLDEGLAITASIDILEDIANNILPEYFLPVVGYSCWTANQLTDEIKSNDWIVTNKLNKKILFNHENKVKWQNHLEHAGYTLQSLDTLFNRNTGNC GT:EXON 1|1-194:0| SW:ID Y963_FRATM SW:DE RecName: Full=UPF0301 protein FTM_0963; SW:GN OrderedLocusNames=FTM_0963; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->194|Y963_FRATM|e-115|100.0|194/194| BL:PDB:NREP 1 BL:PDB:REP 6->185|2gzoA|7e-28|33.9|177/187| RP:PDB:NREP 1 RP:PDB:REP 1->177|2do8A|5e-51|25.7|175/188| RP:PFM:NREP 1 RP:PFM:REP 19->173|PF02622|6e-27|39.9|148/157|DUF179| HM:PFM:NREP 1 HM:PFM:REP 18->177|PF02622|2.4e-45|36.8|155/161|DUF179| RP:SCP:NREP 1 RP:SCP:REP 4->179|2aj2A1|2e-47|33.5|173/179|d.310.1.1| HM:SCP:REP 1->188|2do8A1|7e-47|33.3|186/0|d.310.1.1|1/1|VC0467-like| OP:NHOMO 440 OP:NHOMOORG 439 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-1-----1-1111-1--111111111111111111-1-----11-----------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111111111111111-111111111-11111111111-11111111111111111111111111111111111-1111111------------1111111111111-------11111111111111111111111111111111111111111111111111111111111111111111111111-1111-----------------------1----------------------------111111111111111111111111111111111--1111-1----11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1-111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 95.4 SQ:SECSTR cccccTTEEEEcccccTTccTccccccEEEEEETTEEEEEccccEEEEEHHHHHHHTTccccccGGGccccEEEEcccEEEEEEEEEEcccTTccccEEEcccccEEEcccHHHHHTTcTTccccEEEEEEEEEEcTTHHHHHHHTTccEEEEEccTHHHHTTTccccccHHHHTTTcccccccc######### PSIPRED cEEcccccEEEEccccccccEEccEEEEEEEEcccccEEEEEcccccccHHHHHHHccccccccHHHHHcccEEccccccccEEEEEEccccccccccEEEcccEEEEEcHHHHHHHHccccccEEEEEEEEccccccHHHHHHHcccEEEEccccHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHcccc //