[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30892.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 23->111 PUS3_MOUSE 6e-04 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30892.1 GT:GENE ACD30892.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1049234..1049605) GB:FROM 1049234 GB:TO 1049605 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30892.1 GB:DB_XREF GI:187712595 LENGTH 123 SQ:AASEQ MSRRYCVIKENQKMRTLLSIIKSNYNSDNKDSLQEVNLEHVLNRIFDQDIKVLVKNAWKDLEIIAGQEIRLLENNCKKNFINRLYKKTKDMNFIVKTELNDDTAVINFNSTSNLKLEHKYINI GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 23->111|PUS3_MOUSE|6e-04|32.1|84/100| OP:NHOMO 16 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112223221---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 111-111,115-118| PSIPRED ccccEEEEEEHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccEEEcccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccEEEEEEccccccEEEEEEccc //