[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30897.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.5
:97 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->90 1ub9A PDBj 5e-09 33.3 %
:RPS:PDB   9->77 2a61A PDBj 1e-07 19.1 %
:RPS:SCOP  1->88 2jn6A1  a.4.1.19 * 4e-08 9.5 %
:HMM:SCOP  3->97 1xmaA_ a.4.5.61 * 7e-12 19.1 %
:HMM:PFM   9->55 PF01022 * HTH_5 1.4e-06 26.1 46/47  
:HMM:PFM   37->87 PF01755 * Glyco_transf_25 0.00099 20.0 50/200  
:BLT:SWISS 5->88 Y432_METJA 7e-11 34.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30897.1 GT:GENE ACD30897.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1055614..1055907 GB:FROM 1055614 GB:TO 1055907 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ACD30897.1 GB:DB_XREF GI:187712600 LENGTH 97 SQ:AASEQ MLNDILHQPIRTKIITYLYSVDSATFKDIKTLLELTDGHMSTHMKVFIKNGYVIYKKSFKSGKPMTTYTITPKGKELFLDYVAELKRIVNFISANPS GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 5->88|Y432_METJA|7e-11|34.5|84/100| BL:PDB:NREP 1 BL:PDB:REP 1->90|1ub9A|5e-09|33.3|87/100| RP:PDB:NREP 1 RP:PDB:REP 9->77|2a61A|1e-07|19.1|68/142| HM:PFM:NREP 2 HM:PFM:REP 9->55|PF01022|1.4e-06|26.1|46/47|HTH_5| HM:PFM:REP 37->87|PF01755|0.00099|20.0|50/200|Glyco_transf_25| RP:SCP:NREP 1 RP:SCP:REP 1->88|2jn6A1|4e-08|9.5|84/89|a.4.1.19| HM:SCP:REP 3->97|1xmaA_|7e-12|19.1|94/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 66 OP:NHOMOORG 54 OP:PATTERN -------------------------11--1------1------------------------------- --1-----11---------------------------------------------------------------------------------1-------121---111-1---------------11-232111-11-------1------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--133--------122------11------------1111111-------------------1-2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111----------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 96.9 SQ:SECSTR cccHHHccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTTEEEEEEEEEcHHHHHHHHHHHHHcHHHHHHHTT### PSIPRED cccHHHccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccc //