[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30908.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->87 PF07843 * DUF1634 8.1e-15 34.6 81/105  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30908.1 GT:GENE ACD30908.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1067270..1067536 GB:FROM 1067270 GB:TO 1067536 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30908.1 GB:DB_XREF GI:187712611 LENGTH 88 SQ:AASEQ MIKENVIYKSLKLNLFVAILFIIIGALNAFTGNYSITKNIISIGILLIIISPLLRIFLELIFFIKEKNYTYVLVCIILFVIIAISVVC GT:EXON 1|1-88:0| TM:NTM 3 TM:REGION 11->33| TM:REGION 39->61| TM:REGION 69->88| SEG 35->64|sitkniisigilliiispllrifleliffi| HM:PFM:NREP 1 HM:PFM:REP 7->87|PF07843|8.1e-15|34.6|81/105|DUF1634| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,67-67,73-74,76-76,80-81,87-89| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHc //