[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30914.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.61.1
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   153->233 3h3aB PDBj 4e-04 32.1 %
:HMM:SCOP  22->239 1fsiA_ d.61.1.1 * 8.3e-26 21.0 %
:HMM:PFM   86->211 PF06299 * DUF1045 1.9e-05 19.4 124/160  
:BLT:SWISS 60->137 MSH2_SCHPO 2e-05 32.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30914.1 GT:GENE ACD30914.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1074870..1075589 GB:FROM 1074870 GB:TO 1075589 GB:DIRECTION + GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD30914.1 GB:DB_XREF GI:187712617 LENGTH 239 SQ:AASEQ MKHKLFYKLFILFAFLFITLDSFAESFKQYNVYLIPDTTADKYVKEFDDSLAKTNVLEKYKTTPFIKNHPVHLTLYLTSFQSKYIKDINSQLANLAKNTEPFYIETNGFSAGKSGFVMLDIKNSQSLQQLSNVVIKDLAKYRDKDYPAPSWIKFYPSKLVSFEKYGSPNAFAEFNPHISILAANLQTDQERDNFDKDFNEIIKNTKLEPISFKIKAIGFGEVDENGQVTKILHIYKLNK GT:EXON 1|1-239:0| BL:SWS:NREP 1 BL:SWS:REP 60->137|MSH2_SCHPO|2e-05|32.9|73/982| TM:NTM 1 TM:REGION 4->26| SEG 4->20|klfyklfilfaflfitl| BL:PDB:NREP 1 BL:PDB:REP 153->233|3h3aB|4e-04|32.1|81/418| HM:PFM:NREP 1 HM:PFM:REP 86->211|PF06299|1.9e-05|19.4|124/160|DUF1045| HM:SCP:REP 22->239|1fsiA_|8.3e-26|21.0|176/183|d.61.1.1|1/1|LigT-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ----11-------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 33.9 SQ:SECSTR ########################################################################################################################################################TTccEEEEEETTTTEEEEEETTTEEEEEEEcccccTTHHHHHTcccGGGccEEEccGGGTTEEEcTTcHHHHHHTEEcccc###### DISOP:02AL 8-20| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEcccccHHHHHHHcccccccHHHHHccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEEccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccHHHHccccEEEEEccccccHHHHHHHHHHHHHHcccccccEEEEEccEEcccccccccEEEEEEEEEEcc //