[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30916.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y995_FRATM   RecName: Full=UPF0145 protein FTM_0995;

Homologs  Archaea  8/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.230.5
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->106 1y2iA PDBj 4e-08 33.7 %
:RPS:SCOP  1->105 1vr4A1  d.230.5.1 * 2e-22 34.0 %
:HMM:SCOP  1->106 1y2iA_ d.230.5.1 * 2.2e-32 44.3 %
:RPS:PFM   2->103 PF01906 * DUF74 7e-12 39.6 %
:HMM:PFM   1->106 PF01906 * DUF74 5.8e-35 45.7 105/105  
:BLT:SWISS 1->106 Y995_FRATM 8e-47 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30916.1 GT:GENE ACD30916.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1076999..1077319 GB:FROM 1076999 GB:TO 1077319 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30916.1 GB:DB_XREF GI:187712619 LENGTH 106 SQ:AASEQ MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGGKNTSYTNVCKEARLHAEQEMINQAKELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR GT:EXON 1|1-106:0| SW:ID Y995_FRATM SW:DE RecName: Full=UPF0145 protein FTM_0995; SW:GN OrderedLocusNames=FTM_0995; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->106|Y995_FRATM|8e-47|100.0|106/106| SEG 34->47|gilgglkniiggkn| BL:PDB:NREP 1 BL:PDB:REP 4->106|1y2iA|4e-08|33.7|101/106| RP:PFM:NREP 1 RP:PFM:REP 2->103|PF01906|7e-12|39.6|101/105|DUF74| HM:PFM:NREP 1 HM:PFM:REP 1->106|PF01906|5.8e-35|45.7|105/105|DUF74| RP:SCP:NREP 1 RP:SCP:REP 1->105|1vr4A1|2e-22|34.0|103/103|d.230.5.1| HM:SCP:REP 1->106|1y2iA_|2.2e-32|44.3|106/0|d.230.5.1|1/1|YbjQ-like| OP:NHOMO 80 OP:NHOMOORG 79 OP:PATTERN ------------1-1--1------------1-2---------1------------1---1-------- --1-------------------------------------------------1----------------------------------------1-----------------------------------------------111--------------------------------------------1----1-----------------11--------1---------11------------------------------------------------------------------------------------------1-------------------11----------1-------------1--1---1-----------1------------------------------------------------1-------------------------1-----------------------------------------1111111111111-111111111----------------------------1-----------------------------------------------------------------------------------1------1---------------------------------------------------------------------------------------------------------------------1111--1-----------------------1----------------------111111111----------11----1---------------1------------------------------------------1--11-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 98.1 SQ:SECSTR cEEccccccTTEEEEEEEEEEEEEEEEcHHHHHHHTTTccccccTTTcTHHHHHHHHHHHHHHHHHHHHHHHTccEEEEEEEEEEEEcTT##ccEEEEEEEEEEEE DISOP:02AL 106-107| PSIPRED cEEEcccccccEEEEEEEEEEEEEEEEEEcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHHccccccEEEEEEEEEEEEEc //