[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30920.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   35->114 2bbeA PDBj 3e-06 19.2 %
:RPS:SCOP  39->114 1iujA  d.58.4.5 * 1e-05 17.6 %
:HMM:SCOP  38->101 1iujA_ d.58.4.5 * 0.00079 22.2 %
:HMM:PFM   41->99 PF03992 * ABM 2.8e-06 25.9 58/78  
:HMM:PFM   6->45 PF00499 * Oxidored_q3 0.00094 27.5 40/144  
:BLT:SWISS 25->139 RAD50_CAEEL 8e-05 26.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30920.1 GT:GENE ACD30920.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1081914..1082339 GB:FROM 1081914 GB:TO 1082339 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30920.1 GB:DB_XREF GI:187712623 LENGTH 141 SQ:AASEQ MFFKDIFLKIMIIFSVAIGFLFIFLNTSNAKEKNNSEPILEIVSFETAKNTTTEQVLQASDKVTQDLQGSNGFIKRTLTQNTNNPNQWVDIIEWQSIKDAHSSMDKAVADKDLQVFLKLMKNGSRVYQTKSEYLSIKSQTE GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 25->139|RAD50_CAEEL|8e-05|26.2|103/1298| TM:NTM 1 TM:REGION 5->26| RP:PDB:NREP 1 RP:PDB:REP 35->114|2bbeA|3e-06|19.2|78/103| HM:PFM:NREP 2 HM:PFM:REP 41->99|PF03992|2.8e-06|25.9|58/78|ABM| HM:PFM:REP 6->45|PF00499|0.00094|27.5|40/144|Oxidored_q3| RP:SCP:NREP 1 RP:SCP:REP 39->114|1iujA|1e-05|17.6|74/102|d.58.4.5| HM:SCP:REP 38->101|1iujA_|0.00079|22.2|63/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 56.0 SQ:SECSTR ##################################ccccEEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEcc#HHHHHHHHTcHHHHHHH########################### DISOP:02AL 17-17,25-46| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccEEEEEEEEEHHHHHHHHHHHHHcccHHHHHHHccccccEEEEHHHHHHHHHccc //