[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30921.1
DDBJ      :             carbon-nitrogen hydrolase family protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  123/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.160.1
:306 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   20->219 1f89A PDBj 2e-13 31.1 %
:RPS:PDB   22->288 2e11A PDBj 1e-29 15.1 %
:RPS:SCOP  20->288 1f89A  d.160.1.1 * 4e-29 24.7 %
:HMM:SCOP  14->293 1f89A_ d.160.1.1 * 2.7e-37 25.1 %
:RPS:PFM   44->194 PF00795 * CN_hydrolase 3e-09 31.0 %
:HMM:PFM   25->194 PF00795 * CN_hydrolase 2.4e-18 27.4 164/184  
:BLT:SWISS 33->284 YHCX_BACSU 8e-24 29.9 %
:PROS 74->102|PS00061|ADH_SHORT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30921.1 GT:GENE ACD30921.1 GT:PRODUCT carbon-nitrogen hydrolase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1082417..1083337 GB:FROM 1082417 GB:TO 1083337 GB:DIRECTION + GB:PRODUCT carbon-nitrogen hydrolase family protein GB:PROTEIN_ID ACD30921.1 GB:DB_XREF GI:187712624 LENGTH 306 SQ:AASEQ MFKNIKSLILFCLLMSGCYAQTINVAAAQMIIKQQSFDEFASDIKRLAKQAKDQGAEIVVFPEDNSVNLIDDLPWNKQSIIKLSEYYSQTKSFIANLAKEYSMIVIGGTIAKNDNGKISNTVLIGLPDGQIIENDKIYLTPEERSIGYNKFGKNILVLDYKGTKMAILICYTSEFPNISLELAKIKPDIIIVPSYTNDLYGLNRVHNAVKMLSIQNFAYGVIVGIASGFDKQNTQGIDGVSQILFTSPQNKAFALNHLSRGNFNKEDVVVENLDITKLHQAHKNYDAFPNEDIKYNQNLTIKSVSI GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 33->284|YHCX_BACSU|8e-24|29.9|251/513| PROS 74->102|PS00061|ADH_SHORT|PDOC00060| BL:PDB:NREP 1 BL:PDB:REP 20->219|1f89A|2e-13|31.1|193/271| RP:PDB:NREP 1 RP:PDB:REP 22->288|2e11A|1e-29|15.1|251/265| RP:PFM:NREP 1 RP:PFM:REP 44->194|PF00795|3e-09|31.0|145/171|CN_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 25->194|PF00795|2.4e-18|27.4|164/184|CN_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00795|IPR003010| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF00795|IPR003010| RP:SCP:NREP 1 RP:SCP:REP 20->288|1f89A|4e-29|24.7|255/271|d.160.1.1| HM:SCP:REP 14->293|1f89A_|2.7e-37|25.1|267/281|d.160.1.1|1/1|Carbon-nitrogen hydrolase| OP:NHOMO 144 OP:NHOMOORG 132 OP:PATTERN ------------------------------------------------------111-11-------- ----------------------------------------------------------------------------------------1111-1-----1-1-11111-1------------------------11---------1-------------------------------------1--------11---------------121111----1--1--------112-------------------------------------1----------------------------------------------------2--------------111----------------1----------------1-------------------------------------------1----------------111---1111-11--------1-------------------------------------11----111----------------------------------------------1--111----------1-----212-1------------1---------------------------------1---------111-1111----------------------2212---------------------------------------------------111-1111111-1--1--------------------------------11111122----------------------111--11-1--1-12111----2--1-11-------------1-11--------------------1111---------------------------------------111-1-1--- ---------------------------------------------------------------------------11--1-----------------------------------------------------------------------------------------1----------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 90.8 SQ:SECSTR ##############TcTGGGTcEEEEEEEccccTTcHHHHHHHHHHHHGGGTcTTccEEEccTTTTTTTTcTTccccGGGGGcEETTcHHHHHHHHHHHHHTcEEEEEEEEEcETTEEEEEEEEEcTTccEEEEEcccccGGGTTTTTcccccccccEEETTEEEEEEEGGGGGcTTTTccccccccTTcccccEEEEcccGGGHHHHHHHHHHHHHHTTcEEEEEEcEEEcTTccEEEEEEEEcccTTcccTTccEEEEEEccccEEEEEEEcHHHHHHHHHHccGGcHHH############## PSIPRED ccccHHHHHHHHHcccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEEEEcccccEEEEEEEEccccEEEEEEccccccccccccccccccccEEEEEccEEEEEEEccccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccccccEEcccccEEEEcccccEEEccccccccccccEEEEEEEcHHHHHHHHHHccccccccccccccccEEEEEc //