[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30922.1
DDBJ      :             para-aminobenzoate synthase component I
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  765/915 : Eukaryota  123/199 : Viruses  1/175   --->[See Alignment]
d.161.1e.17.1
:587 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->85 1rznB PDBj 2e-04 28.4 %
:BLT:PDB   118->372 1k0eA PDBj 7e-39 36.1 %
:BLT:PDB   505->582 3cswC PDBj 1e-05 31.2 %
:RPS:PDB   50->377 3bznA PDBj 3e-73 17.6 %
:RPS:PDB   405->582 1a3gA PDBj 7e-25 18.9 %
:RPS:SCOP  55->374 1qdlA  d.161.1.1 * 2e-85 28.8 %
:RPS:SCOP  364->582 1et0A  e.17.1.1 * 3e-27 14.6 %
:HMM:SCOP  41->386 1i7qA_ d.161.1.1 * 6.9e-90 27.3 %
:HMM:SCOP  355->582 1et0A_ e.17.1.1 * 3.8e-37 22.0 %
:RPS:PFM   117->364 PF00425 * Chorismate_bind 4e-41 34.3 %
:RPS:PFM   505->582 PF01063 * Aminotran_4 4e-10 32.1 %
:HMM:PFM   116->368 PF00425 * Chorismate_bind 1.5e-82 34.4 250/257  
:HMM:PFM   395->582 PF01063 * Aminotran_4 6.1e-38 29.9 184/232  
:BLT:SWISS 118->368 PABS_STRGR 3e-42 36.7 %
:BLT:SWISS 430->527 ZN577_HUMAN 2e-04 29.5 %
:BLT:SWISS 498->580 Y1169_HAEIN 7e-08 29.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30922.1 GT:GENE ACD30922.1 GT:PRODUCT para-aminobenzoate synthase component I GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1086271..1088034) GB:FROM 1086271 GB:TO 1088034 GB:DIRECTION - GB:PRODUCT para-aminobenzoate synthase component I GB:PROTEIN_ID ACD30922.1 GB:DB_XREF GI:187712625 LENGTH 587 SQ:AASEQ MSNNQLPQFAILEDTLTDKQKYYFYNPIAEVIANSKETLELAFYQLEKLQQQRLYLVGYLSYEASYYLNNNLYDLRDPDDSKLLHFVAFSDYSNEIPDDLISDKNIDMMIDSLNFADYQKSFDKVQQALIDGESYQINLTKNILATTKLTSYELYNKLKQQQSVKYAAYLPFLNPDIISISPELFFKKDAENLVVNPMKGTARLTGNELKDLKIYQELALCDKNRAENLIIVDLLRNDLSAIAKTHTVKVDKLFSIEKYKNLLQMTSQISAKVDKQISFRKILDGLFPCGSISGAPKKRTMELIKQIEKGKRGVYTGSIGYIMPNNDMCFNVAIRTIQKYRDNLQIGVGGGITVYSDVQSEWQEMNTKINFIRQIYQPDFCLIESLYYCNQFRDLELHLERLEDSARQLFFDIDICKIRDQLYDYVEKLTDDKEYKIRIEYHYDKSIIIEHTQIDTTNQQAIKLIICPEKINSANKLFQHKTTHNSTRGFYTQMHQKYIQDKNCELIYLNEKDNITETRFHNIIIEKNDKFYTPKLEDGVLAGIARKSLIKQGKLQAKSLNLNDLKTADKIYLINSVRGLIPAYLGI GT:EXON 1|1-587:0| BL:SWS:NREP 3 BL:SWS:REP 118->368|PABS_STRGR|3e-42|36.7|251/723| BL:SWS:REP 430->527|ZN577_HUMAN|2e-04|29.5|95/478| BL:SWS:REP 498->580|Y1169_HAEIN|7e-08|29.6|81/188| SEG 393->404|rdlelhlerled| BL:PDB:NREP 3 BL:PDB:REP 12->85|1rznB|2e-04|28.4|74/150| BL:PDB:REP 118->372|1k0eA|7e-39|36.1|241/437| BL:PDB:REP 505->582|3cswC|1e-05|31.2|77/273| RP:PDB:NREP 2 RP:PDB:REP 50->377|3bznA|3e-73|17.6|323/430| RP:PDB:REP 405->582|1a3gA|7e-25|18.9|175/295| RP:PFM:NREP 2 RP:PFM:REP 117->364|PF00425|4e-41|34.3|248/258|Chorismate_bind| RP:PFM:REP 505->582|PF01063|4e-10|32.1|78/220|Aminotran_4| HM:PFM:NREP 2 HM:PFM:REP 116->368|PF00425|1.5e-82|34.4|250/257|Chorismate_bind| HM:PFM:REP 395->582|PF01063|6.1e-38|29.9|184/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 2 RP:SCP:REP 55->374|1qdlA|2e-85|28.8|320/415|d.161.1.1| RP:SCP:REP 364->582|1et0A|3e-27|14.6|213/254|e.17.1.1| HM:SCP:REP 41->386|1i7qA_|6.9e-90|27.3|344/517|d.161.1.1|1/1|ADC synthase| HM:SCP:REP 355->582|1et0A_|3.8e-37|22.0|218/266|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 2193 OP:NHOMOORG 947 OP:PATTERN 11-1--1111111111-112222142223323111111111111111111111111--1--111--11 1111332222243243322-2322332222233222333323232121232222222222221123533211111211----333333222212-1-1121222222232--------------133323333333111221112243523231122222222323234312233233233332222221-233444443343434443223334443233343322222222133333233333333332331----------11-------12-32211111112112222222222211111111111112--222----32-13----------111111111-1-221112443111--223113-211322222-----222112221121144344444442-22222222232-2222233222222222211222222332222222212212122-----------------------------22222233333233332322222222333323222222222222222221222332222222422222222111222-3222122122222-122222222222243122122-22222122222222222222224432222222333333333333333333331-12232-1---164343324435455544-4444445455455444444334445534444444444444444444433342-4444443343432212221122222223333331332333332333334323222224334332422222233222222222223335333334334422222222223222222-222222--------------------------------------1--1-111232 11----1-1---2222222222324332222222222222222222222223232222233322222212223222212222222222-22222222222232222-12-------------------------------------------------1----------------2122E322224345172-132221 --1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 573 STR:RPRED 97.6 SQ:SECSTR ###########HHHHHHHHHHHHHHTTccEEEEccccccccccccccccTcEEEEEEEEEEEEETTEEEEEEEEEEcccHHHHHHHHHHHHHTcccccccccccccEEEEEEccHHHHHHHHHHHHHHHTTTcccEEEEEEEEEEEEcccHHHHHHHHHHHcTTcEEEEEEEETTEEEEEEccEEEEEETTEEEEEEEEEEEEccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTccccEEcccEEEEEEEcccEEEEEEEEEEEccccccHHHHHHHHcccTTTcEEcHHHHHHHHHHHcccccTTTTcEEEEEcccEcEEEEEcccEEEEETTEEEEEEEEEEcTTccHHHHHHHHHHHHHHHHTTTcHccEEEccETTEEEEEcHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHTTTcccEEEEEEEEEccccccccccTTccEcccccEEEcccccccTTTcTTcccGGGcGHHHHHHHHHHHHTTTccEEEEEcTTccEEEEcccEEEEEcccccccccGGGTccccHHHHHHHHHHccccccccTTHHHHccEEEEEETTTEEEEcc### PSIPRED ccccccccEEEEEccccccccEEEcccHHHHccccHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHccccccccccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEccccHHHHHHHHHHHccccEEEEEEcccEEEEEccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccEEEEEEEEEEEEcccccHHHHHHHHccccccccccHHHHHHHHHHHccccccccEEEEEEEcccccEEEEEEEEEEEEEccEEEEEEcccccccccHHHHHHHHHHHHHcccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEcccccccccEEEEEEEEEccccccHHHHHcccccHHHHHHHHHHHHHHccccEEEEEcccccEEEccccEEEEEEccEEEEccccccccccHHHHHHHHcccEEEEEccHHHHHcccEEEEEEccccEEEEEEEc //