[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30937.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y1023_FRATM  RecName: Full=UPF0133 protein FTM_1023;

Homologs  Archaea  0/68 : Bacteria  252/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:112 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   29->84 1j8bA PDBj 7e-12 57.4 %
:RPS:SCOP  38->86 1j8bA  d.222.1.1 * 5e-20 51.0 %
:HMM:SCOP  9->106 1pugA_ d.222.1.1 * 2.2e-26 53.2 %
:RPS:PFM   30->84 PF02575 * DUF149 3e-11 70.9 %
:HMM:PFM   9->88 PF02575 * DUF149 4.1e-34 60.0 80/93  
:BLT:SWISS 1->112 Y1023_FRATM 1e-47 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30937.1 GT:GENE ACD30937.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1104850..1105188 GB:FROM 1104850 GB:TO 1105188 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30937.1 GB:DB_XREF GI:187712640 LENGTH 112 SQ:AASEQ MNFDMSKLVQQAQKMQEQMKKAQQERENMEVIGESGAGLVTVTMTGKYDVKSVSIDNSLMSEDKEILEDLIAAAVNSAVKKVEENSTASSDIYKMAKDAGIDLPSGINFPFK GT:EXON 1|1-112:0| SW:ID Y1023_FRATM SW:DE RecName: Full=UPF0133 protein FTM_1023; SW:GN OrderedLocusNames=FTM_1023; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->112|Y1023_FRATM|1e-47|100.0|112/112| SEG 10->25|qqaqkmqeqmkkaqqe| BL:PDB:NREP 1 BL:PDB:REP 29->84|1j8bA|7e-12|57.4|54/85| RP:PFM:NREP 1 RP:PFM:REP 30->84|PF02575|3e-11|70.9|55/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 9->88|PF02575|4.1e-34|60.0|80/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 38->86|1j8bA|5e-20|51.0|49/92|d.222.1.1| HM:SCP:REP 9->106|1pugA_|2.2e-26|53.2|94/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 254 OP:NHOMOORG 254 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-11--111-------------------------1--1-11------------111111111-1-11111111111-1--1------------1---11111111-1-11-1----111111111111111111111111111111-1-111111111111111111111-11---------1111----------------------------------------------------------11-111111111111111111111111111111-11111-1-111---11----------1------------------------1111--------------------------1111111111111----111111111111-1111-1-11111111-111111111-11111111-11111111111111111111----111111111111111111111-------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 68.8 SQ:SECSTR ############################cEEEEEEGGGTEEEEEETTccEEEEEEcGGGHHGccHHHHHHHHHHHHHHHHHHHHHHHHHHHT#HHHHHHTTccccc###### PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEccccEEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //