[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30950.1
DDBJ      :             glycosyl transferase family 2 protein
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  616/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:319 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->104 2z87B PDBj 1e-20 36.5 %
:RPS:PDB   6->197 3bcvA PDBj 3e-25 33.0 %
:RPS:SCOP  6->222 1h7lA  c.68.1.1 * 6e-26 12.9 %
:HMM:SCOP  6->221 1qg8A_ c.68.1.1 * 9.7e-54 33.7 %
:RPS:PFM   8->105 PF00535 * Glycos_transf_2 2e-25 51.0 %
:HMM:PFM   9->170 PF00535 * Glycos_transf_2 2.5e-43 33.3 162/169  
:BLT:SWISS 6->214 EPSJ_BACSU 3e-30 35.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30950.1 GT:GENE ACD30950.1 GT:PRODUCT glycosyl transferase family 2 protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1119110..1120069) GB:FROM 1119110 GB:TO 1120069 GB:DIRECTION - GB:PRODUCT glycosyl transferase family 2 protein GB:PROTEIN_ID ACD30950.1 GB:DB_XREF GI:187712653 LENGTH 319 SQ:AASEQ MKYCELITLVIPIYNIENYLGRCLDSVINQTYKDLEIILVNDASTDNSLEICESYAKEDSRIKIINKNNGGLSSARNVGLDACKGDYVTFIDSDDWVSLDYIEILYKNIIDNNADISIINAIKVKSQNNDFTLKEQKNLLHTYFSSIEFALDNTLPVMACAKLYKTKLFENLRFTNSIVFEDEDIMYRLLYHANKIVCTDYIGYFYFQRPTSITSSKKKRQNIIKSSDSLIFVLTKKEQFFKGKTTIPYKFYIDSAGLLSRYYAKSFLYPFDKEMIKQRKKIKLFINKLLQNTKSIETFRYKIKRNFIKYFVFFFLFKD GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 6->214|EPSJ_BACSU|3e-30|35.4|209/344| SEG 108->122|niidnnadisiinai| SEG 307->317|fikyfvffflf| BL:PDB:NREP 1 BL:PDB:REP 1->104|2z87B|1e-20|36.5|104/591| RP:PDB:NREP 1 RP:PDB:REP 6->197|3bcvA|3e-25|33.0|182/192| RP:PFM:NREP 1 RP:PFM:REP 8->105|PF00535|2e-25|51.0|98/148|Glycos_transf_2| HM:PFM:NREP 1 HM:PFM:REP 9->170|PF00535|2.5e-43|33.3|162/169|Glycos_transf_2| RP:SCP:NREP 1 RP:SCP:REP 6->222|1h7lA|6e-26|12.9|209/239|c.68.1.1| HM:SCP:REP 6->221|1qg8A_|9.7e-54|33.7|208/255|c.68.1.1|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1716 OP:NHOMOORG 660 OP:PATTERN 11----11----------1-1--11-----1-CB-11-1-3121412112244-2342422---2-12 115111----------111-1-----11111--1-1-3--2-1115311-1111-1-1--2311---699452226532184-14123AGF8-B23---D1666533A-7--------------33331524342411136-----16AH998----2----2-254EFA81-11-21-211-----12211-5434345531345433355536533-1215-1222323422121111111111115113562-2354122211--2425212-449433-------53362446271-------------444324444-2--863232323255232216112-3--158112132-212------1-11111--1-----512-1111-11-1--11--11111---21-411432-255146435634-133----11122--11111111-3324224------------2222222222222-------421-111--1132-1-------3------11-1----1-1-1212-11-11-2122-141-31112212-11-2-42621783433314596425A6511214-532-213856775161111111--123--1214242-2-1-1-2-11321-2--21-21---1112------33---131222132223-1212311321221221222212-125411111111111111114-22--11--222222222212--1----------125--21111111212---31-111-21--532111121----11-2117222222221-112-------2----1-1---------1-44335544111111115--------1-----1---2212-----22132--1-1378 ----33----------------------------------------------------------------------------------------------------------------------2--------------------------------122-1------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 292 STR:RPRED 91.5 SQ:SECSTR EcccccEEEEEEEcccTTTHHHHHHHHHTcccccEEEEEEEccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccEEEEccTTccccTTHHHHHHHHHHHHHTccEEEccEEEccHHHHHHHHGHHHTHGGTcccHHHHHHHHHHHTcccEEEEHHHHHHTTcTTTcTTHHHHHHHHHHTTcccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHTTccccccccEEccccEEccccccccccHccccccGGGGccGHHTcTTHHHHcccccccccEE########################### PSIPRED ccccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEccccccccccHHHHHHHHHccccEEcccHHHEEHHHHHHccccccccHHHHHHHHHHHHccccEEEEcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccc //