[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30952.1
DDBJ      :             methyltransferase domain family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:209 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   28->201 1y8cA PDBj 3e-06 27.4 %
:RPS:PDB   2->209 3e8sA PDBj 7e-10 13.2 %
:RPS:SCOP  43->139 2p7hA1  c.66.1.41 * 1e-10 21.9 %
:HMM:SCOP  5->209 1wznA1 c.66.1.43 * 3.6e-20 16.7 %
:HMM:PFM   42->112 PF00398 * RrnaAD 3.4e-10 19.7 71/262  
:HMM:PFM   87->139 PF01739 * CheR 1.4e-05 13.2 53/196  
:HMM:PFM   118->195 PF06859 * Bin3 0.00024 24.7 77/110  
:BLT:SWISS 27->163 Y1106_OCEIH 1e-06 24.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30952.1 GT:GENE ACD30952.1 GT:PRODUCT methyltransferase domain family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1120843..1121472) GB:FROM 1120843 GB:TO 1121472 GB:DIRECTION - GB:PRODUCT methyltransferase domain family GB:PROTEIN_ID ACD30952.1 GB:DB_XREF GI:187712655 LENGTH 209 SQ:AASEQ MNKKIEAYYDILSRKIKSPYETRNKSKDFSQYDIFLVKKLADRSKNLLDLGSGTGLLINSIHNCFKKIVAVEKYKEFSDFIIRKPNIDIINEDITNFKTHEKFDTITIFGVMNFFNAQEAKYVYKKVLSMMHTNGVLIIKNQFGLNDNVVIDGYSEELKSNYYSEYRYIDGEINLLQKIGFDSIEKIDIYPKEYNRWSNTHFYALVCKR GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 27->163|Y1106_OCEIH|1e-06|24.8|137/213| BL:PDB:NREP 1 BL:PDB:REP 28->201|1y8cA|3e-06|27.4|164/244| RP:PDB:NREP 1 RP:PDB:REP 2->209|3e8sA|7e-10|13.2|204/216| HM:PFM:NREP 3 HM:PFM:REP 42->112|PF00398|3.4e-10|19.7|71/262|RrnaAD| HM:PFM:REP 87->139|PF01739|1.4e-05|13.2|53/196|CheR| HM:PFM:REP 118->195|PF06859|0.00024|24.7|77/110|Bin3| RP:SCP:NREP 1 RP:SCP:REP 43->139|2p7hA1|1e-10|21.9|96/229|c.66.1.41| HM:SCP:REP 5->209|1wznA1|3.6e-20|16.7|204/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHTccHHHHHTHHHHHHHHHHHTccEEEEETcTTcHHHHHHHTTTcEEEEEEccHHHHHHHHHTccccEEEccHHHHHTTccccccEEEEEEEccccccccHHHHHHHHTEEEEEEEEEccTTTTcTTccccEEEEEccTTcccccccEHHHHHHHHHHTEEEEEEEccccHGGHTTccccccEEEEEE PSIPRED ccHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHcccccEEHHHHHccccccccHHEEHHHHHHHccHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHccEEEEEEcc //