[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30961.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  169/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->206 3bwwA PDBj 2e-23 36.6 %
:RPS:PDB   7->172 3bwwA PDBj 1e-20 40.4 %
:RPS:PFM   7->259 PF05114 * DUF692 9e-48 39.0 %
:HMM:PFM   5->268 PF05114 * DUF692 1.9e-85 35.9 262/275  
:BLT:SWISS 7->263 Y2857_SHESH 4e-55 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30961.1 GT:GENE ACD30961.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1131039..1131854) GB:FROM 1131039 GB:TO 1131854 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30961.1 GB:DB_XREF GI:187712664 LENGTH 271 SQ:AASEQ MIGKCQGIGLRSGHQSILSTQKVDGIDFLELSPENWMGLGGFKQVYLDKVASIYPLIAHGLSLSIGGFQPLNKKFLNEIRAFLDDYNIEIYSDHLCFSDDDNKGYLYDLLPVPREKENISYICNRIEQVQEIIKRPLSLENISYYYQYDNDMNELDFINAILQRSGAKMLLDINNVYVNGHNHNYNAYEFIKGINKGSVSYYHIAGHYKKDDFILDTHGKDVIQEVKELAKFAVEQHGWHPMLLERDHFVPKLDDLVNELNSITNVIEGKI GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 7->263|Y2857_SHESH|4e-55|40.0|255/278| SEG 174->186|nnvyvnghnhnyn| BL:PDB:NREP 1 BL:PDB:REP 6->206|3bwwA|2e-23|36.6|186/246| RP:PDB:NREP 1 RP:PDB:REP 7->172|3bwwA|1e-20|40.4|151/246| RP:PFM:NREP 1 RP:PFM:REP 7->259|PF05114|9e-48|39.0|251/271|DUF692| HM:PFM:NREP 1 HM:PFM:REP 5->268|PF05114|1.9e-85|35.9|262/275|DUF692| OP:NHOMO 225 OP:NHOMOORG 172 OP:PATTERN -------------------------------------------------------------------- 11------------1----------1-----------1-----1----------------11--1--111------------------------------------1-----------------1---------------------1-----------1--2----------------1-------------1------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------122------22-121------1--------------1---------1---1-1-1--11---111-----111------------------------------------------------11-1111-------3----111-111-1---1-111--11112----1111--11--111-1111111--1-111-------------------------1-14-----------------------------1--1-1311111222222222211122123------1------------------------------------------------11------------------------------------------1-----3343113------1--1111-111------1----12122222222222----1111-11111---1-----1111121--1------------------------------------------------------------------1- -1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 69.7 SQ:SECSTR #####cEEEccGGGHHHHHccccccccccEEcHHHHHT#cHHHHHHHHHHTTTccEEEccccccTTccccccHHHHHHHHHHHHHTTccccEEcccc###########cccccccHHHHHHHHHHHHHHHHHHTcccEEEccccccccTTcccHHHHHHHHHHHHTcEEEEEHHHHHHHHHHccccHHHHHHHccGGGEEEEEEcc################################################################# DISOP:02AL 271-272| PSIPRED cccccccccccHHHHHHHHHcccccccEEEEccHHHcccccHHHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccEEEEEcHHHHccccccccHHHHHHHHHHHHcccEEEEccEEEEccccccccHHHHHHcccHHHEEEEEEEccccccccEEEcccccccHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHHcc //