[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30978.1
DDBJ      :             sigma54 modulation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  527/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.204.1
:98 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->89 2ywqC PDBj 9e-13 37.6 %
:RPS:SCOP  1->98 1imuA  d.204.1.1 * 7e-28 26.5 %
:HMM:SCOP  1->99 1imuA_ d.204.1.1 * 6.4e-34 47.5 %
:RPS:PFM   3->93 PF02482 * Ribosomal_S30AE 2e-18 53.8 %
:HMM:PFM   2->93 PF02482 * Ribosomal_S30AE 5.4e-36 48.9 92/94  
:BLT:SWISS 1->93 RP5M_PSEPU 1e-25 54.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30978.1 GT:GENE ACD30978.1 GT:PRODUCT sigma54 modulation protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1149374..1149670) GB:FROM 1149374 GB:TO 1149670 GB:DIRECTION - GB:PRODUCT sigma54 modulation protein GB:PROTEIN_ID ACD30978.1 GB:DB_XREF GI:187712681 LENGTH 98 SQ:AASEQ MNIQITGRHVEVTDSIKNYVNEKVGKVEHYFDNITSTKVILDVEKDHQVAEAIVTVPGSEFVAKAEDKDLYAAIDMLEDKLARQLKKHKDKMRCNHGE GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 1->93|RP5M_PSEPU|1e-25|54.8|93/102| BL:PDB:NREP 1 BL:PDB:REP 4->89|2ywqC|9e-13|37.6|85/88| RP:PFM:NREP 1 RP:PFM:REP 3->93|PF02482|2e-18|53.8|91/98|Ribosomal_S30AE| HM:PFM:NREP 1 HM:PFM:REP 2->93|PF02482|5.4e-36|48.9|92/94|Ribosomal_S30AE| GO:PFM:NREP 2 GO:PFM GO:0005488|"GO:binding"|PF02482|IPR003489| GO:PFM GO:0044238|"GO:primary metabolic process"|PF02482|IPR003489| RP:SCP:NREP 1 RP:SCP:REP 1->98|1imuA|7e-28|26.5|98/107|d.204.1.1| HM:SCP:REP 1->99|1imuA_|6.4e-34|47.5|99/107|d.204.1.1|1/1|Ribosome binding protein Y (YfiA homologue)| OP:NHOMO 627 OP:NHOMOORG 528 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1-------------------1---------------------1111--------1-----------------1--------------1-----11--------------1111111111111-1-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111-1111111111-111-1111111111111111111-1---------------------------------------------------------------------------------------1-------------------------------------111-111111111111111111111111111111111111111111111111111111-------111111--11-1-1--1----1111111111-1111111--1------1---------1---111222111111221111122311113132111--11111------22222222222222122-2222222222222222222222222212222222222222222212222222-212122212222--1111111111111111------1----1---------1111111111111111111111111111111111111222222222211-----111111111--111111----------1------------------------------1-1-11-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 94.9 SQ:SECSTR cccEEEEEcccccHHHHHHHHHHHHTTGGGcccccEEEEEEEEEccEEEEEEEEEETTEEEEEEEEEccHHHHHHHHHHHHHHHHHHTccccc##### PSIPRED cEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //