[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30983.1
DDBJ      :             disulfide bond formation protein DsbB family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:HMM:PFM   18->93 PF02600 * DsbB 6.7e-16 30.3 76/156  
:HMM:PFM   107->167 PF00335 * Tetraspannin 3.4e-05 13.2 53/221  
:HMM:PFM   71->127 PF11188 * DUF2975 0.0009 28.1 57/93  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30983.1 GT:GENE ACD30983.1 GT:PRODUCT disulfide bond formation protein DsbB family GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1155101..1155670 GB:FROM 1155101 GB:TO 1155670 GB:DIRECTION + GB:PRODUCT disulfide bond formation protein DsbB family GB:PROTEIN_ID ACD30983.1 GB:DB_XREF GI:187712686 LENGTH 189 SQ:AASEQ MKTFIENDLIKALSAIELMGIAITIIAAFYFQFAMDELPCPLCLLQRLGLLAIGFGFLLNMRFNIRPSHYALSLLAAVFTSFVSLRQIALHVTDPVGFGSKVLGMHMYSWVFVISMIAIIYIAIVMSYPRQYELRRQPQQISETKNNIIRLFIQIIFIIFLLVVFANVVSTFFECGLHECPDDPTRYLF GT:EXON 1|1-189:0| TM:NTM 5 TM:REGION 11->33| TM:REGION 41->62| TM:REGION 75->97| TM:REGION 107->128| TM:REGION 152->174| SEG 38->59|lpcplcllqrlgllaigfgfll| SEG 113->128|vismiaiiyiaivmsy| SEG 146->169|nniirlfiqiifiifllvvfanvv| HM:PFM:NREP 3 HM:PFM:REP 18->93|PF02600|6.7e-16|30.3|76/156|DsbB| HM:PFM:REP 107->167|PF00335|3.4e-05|13.2|53/221|Tetraspannin| HM:PFM:REP 71->127|PF11188|0.0009|28.1|57/93|DUF2975| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccc //