Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30989.1
DDBJ      :             conserved hypothetical protein

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:BLT:PDB   15->139 1lshA PDBj 4e-04 28.7 %
:HMM:PFM   2->57 PF05606 * DUF777 6.2e-05 29.1 55/180  
:BLT:SWISS 10->63 T120B_BOVIN 5e-04 35.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30989.1 GT:GENE ACD30989.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1169669..1170190 GB:FROM 1169669 GB:TO 1170190 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30989.1 GB:DB_XREF GI:187712692 LENGTH 173 SQ:AASEQ MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGSGIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLENAPITTINSKAMCMFAPGGIVDFISSGQINVKTS GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 10->63|T120B_BOVIN|5e-04|35.2|54/339| BL:PDB:NREP 1 BL:PDB:REP 15->139|1lshA|4e-04|28.7|115/954| HM:PFM:NREP 1 HM:PFM:REP 2->57|PF05606|6.2e-05|29.1|55/180|DUF777| OP:NHOMO 17 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------122221222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 66.5 SQ:SECSTR ##############EEEEEEEEEEEcccccTTccHHHHTTccEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEE########EETTTTEEEEEEccccccEEEEEEEEE##EEEEEEETTEEEEEEcccccccc################################## DISOP:02AL 173-174| PSIPRED ccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccEEEEEEEcEEEEcccccEEEEEcccEEEEEEccccHHHHHccHHHHHccccHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEcccEEEccccEEEEEEccccEEEEEEccEEEEEEc //