[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD30995.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30995.1 GT:GENE ACD30995.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1178219..1178794 GB:FROM 1178219 GB:TO 1178794 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD30995.1 GB:DB_XREF GI:187712698 LENGTH 191 SQ:AASEQ MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFLNLNEFCPTNIAACKDENDNNCIYITELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFKNNKHETYYSQVIYNWFVSSELYLSFSEGSIFINKDINNSNNYDKGNFLSVNLERIADGWAPPHYEKKITII GT:EXON 1|1-191:0| SEG 2->17|skkifkllsisiifsi| OP:NHOMO 14 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22221212---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 190-192| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccEEEEEEHHHccccccHHccccccccEEEEHHHHHHHHHHEEEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHccccHHHHHHHHHHEEEcccEEEEEEccEEEEEcccccccccccccEEEEEHHHHcccccccccccEEEEc //