[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31011.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:RPS:PFM   36->202 PF04286 * DUF445 7e-10 32.0 %
:HMM:PFM   38->106 PF04286 * DUF445 1.3e-13 28.4 67/367  
:HMM:PFM   139->227 PF04286 * DUF445 9.1e-10 25.0 88/367  
:HMM:PFM   7->52 PF03899 * ATP_synt_I 0.00054 20.9 43/100  
:BLT:SWISS 87->170 CDPKS_ARATH 6e-04 32.5 %
:BLT:SWISS 157->202 HEM1_HALMA 4e-04 32.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31011.1 GT:GENE ACD31011.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1200838..1201524 GB:FROM 1200838 GB:TO 1201524 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31011.1 GB:DB_XREF GI:187712714 LENGTH 228 SQ:AASEQ MGIFNKSFVTNLVAAILAIIGWYFAEVHIKNIGFYALSGALTNWIAIYMLFEKIPFLYGSGIIPNKFESFKRAIKKMIMEQFFSPQNINNFLKSDDIKRYLADNIAAKIDYNKIFDSFIDMLMSSKYGSMIDVFLGGRSALEGLREPFTKKLDSKVIELLSSIDINTNNVSQKAAEKIERLIDSRLDELTPQMVKEIIQKIIREHLGWLVVWGGVFGGLIGLAASFIS GT:EXON 1|1-228:0| BL:SWS:NREP 2 BL:SWS:REP 87->170|CDPKS_ARATH|6e-04|32.5|77/100| BL:SWS:REP 157->202|HEM1_HALMA|4e-04|32.6|46/448| TM:NTM 3 TM:REGION 3->25| TM:REGION 30->52| TM:REGION 206->228| SEG 206->222|lgwlvvwggvfggligl| RP:PFM:NREP 1 RP:PFM:REP 36->202|PF04286|7e-10|32.0|147/356|DUF445| HM:PFM:NREP 3 HM:PFM:REP 38->106|PF04286|1.3e-13|28.4|67/367|DUF445| HM:PFM:REP 139->227|PF04286|9.1e-10|25.0|88/367|DUF445| HM:PFM:REP 7->52|PF03899|0.00054|20.9|43/100|ATP_synt_I| OP:NHOMO 55 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1------------1-1111111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------4---------------------------------------------------------------2------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //