[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31013.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  135/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:241 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->113 PF02470 * MCE 4e-06 29.7 %
:HMM:PFM   39->113 PF02470 * MCE 1.5e-14 27.0 74/81  
:HMM:PFM   142->227 PF08702 * Fib_alpha 2.6e-05 18.6 86/146  
:BLT:SWISS 32->150 Y1085_HAEIN 7e-06 24.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31013.1 GT:GENE ACD31013.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1202217..1202942) GB:FROM 1202217 GB:TO 1202942 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31013.1 GB:DB_XREF GI:187712716 LENGTH 241 SQ:AASEQ MNENSIKNLIAGLFVIFMVFVMIFIGFFLSGGFKDQHTTTFVTNFKSISGLNVGSDVSYKGFSIGKVSDISINKNNPKLVSVYMKINSQIPIYKQTVATLQSMGITGQSKVELSLDIDAKNTSLDLIHIKKGQIPEITSKPSQLESIMNKVSAIASSLEEISGKFNKMMSPENLDRFNQFTDSVNMLLYNLSNSSIYFNKTLMNLNETMTESQETITRLNNVIRILEYDPSTIVRGVDHKE GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 32->150|Y1085_HAEIN|7e-06|24.8|113/167| TM:NTM 1 TM:REGION 9->31| SEG 12->29|glfvifmvfvmifigffl| RP:PFM:NREP 1 RP:PFM:REP 40->113|PF02470|4e-06|29.7|74/81|MCE| HM:PFM:NREP 2 HM:PFM:REP 39->113|PF02470|1.5e-14|27.0|74/81|MCE| HM:PFM:REP 142->227|PF08702|2.6e-05|18.6|86/146|Fib_alpha| OP:NHOMO 138 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------1------------1----------11-1---1-1-1111-----1-1---------------------1--------------------------------1-11111--1111111111111111111111111111-------1---1--1-11--1-------------2121---1---1-1111--------------1----1-1---11--11--------1---111--1-1-----1-----------------------1----------------------------------------------1--------------------------------1---------------1111111111-----------------------------1-11111111111111---111111111---------------11111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 241-242| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccccccccEEEccEEEEEEEEEEEccccccEEEEEEEEccccccccccEEEEEEccccEEEEEEEEccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccc //