[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31015.1
DDBJ      :             ABC-type transport system permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  571/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
:366 amino acids
:PSIPRED
:RPS:PFM   149->362 PF02405 * DUF140 6e-30 34.1 %
:HMM:PFM   151->361 PF02405 * DUF140 4.9e-70 38.9 211/215  
:HMM:PFM   39->80 PF01740 * STAS 6.1e-05 21.4 42/117  
:BLT:SWISS 160->353 Y1045_SYNY3 1e-26 32.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31015.1 GT:GENE ACD31015.1 GT:PRODUCT ABC-type transport system permease protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1203728..1204828) GB:FROM 1203728 GB:TO 1204828 GB:DIRECTION - GB:PRODUCT ABC-type transport system permease protein GB:PROTEIN_ID ACD31015.1 GB:DB_XREF GI:187712718 LENGTH 366 SQ:AASEQ MEINIDQNTVYFAGLLTLKQINPKLVEKKVSRSKVKLNRIDITKIQALDTAGAYFILKVLKDLELTKEDLVFDNHKDKNLIELVANNFPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEIKASIGFLGAILLGYLTLIRKPYRSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPLNLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSSSAFTSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLTVIAMIANIISGIIIADVIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAVALNGVA GT:EXON 1|1-366:0| BL:SWS:NREP 1 BL:SWS:REP 160->353|Y1045_SYNY3|1e-26|32.5|194/263| TM:NTM 5 TM:REGION 118->139| TM:REGION 169->191| TM:REGION 258->280| TM:REGION 305->327| TM:REGION 342->364| SEG 267->286|iamianiisgiiiadviagi| RP:PFM:NREP 1 RP:PFM:REP 149->362|PF02405|6e-30|34.1|214/215|DUF140| HM:PFM:NREP 2 HM:PFM:REP 151->361|PF02405|4.9e-70|38.9|211/215|DUF140| HM:PFM:REP 39->80|PF01740|6.1e-05|21.4|42/117|STAS| OP:NHOMO 892 OP:NHOMOORG 589 OP:PATTERN -------------------------------------------------------------------- 111-----------36633-35--4433333255654525----------------------3--11111-------------221111111-11-1--11211132222-------111----111111111131----------1122112111111111122111121111111111111-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2312111-----212222-22222211111111111-111111111121111111111111122212112122--111111111222222231111-111111111111111111111111-112122222122222222222222322222222222222222221222222222222221212111111122323252321123233223213133352212122434111-1111111111111111121112211212-111121111123111111111111--11222------11111111111111111-1111111111111111111121111111111111111111111111111111-211111111111--1-1111122222-1111111111111111111111111---212222222222222211122222222211111111111212122222222222222---1221111----------------------------------------------121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------11117111111122-31--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccEEEEEccccHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //