[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31024.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  229/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->62 2hh7A PDBj 5e-08 35.8 %
:RPS:PFM   7->88 PF02583 * DUF156 8e-13 45.6 %
:HMM:PFM   6->89 PF02583 * DUF156 8.4e-28 43.9 82/85  
:BLT:SWISS 12->89 CSOR_BACSU 3e-13 37.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31024.1 GT:GENE ACD31024.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1213688..1213960) GB:FROM 1213688 GB:TO 1213960 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31024.1 GB:DB_XREF GI:187712727 LENGTH 90 SQ:AASEQ MSNPCHKKHLVKLNRVTGQVEAIKRMIDDQRYCVDIITQIKAARSALKSIELSILETHMQSCLEKSCQANSKEVLEQRIAEIMKLLRKYQ GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 12->89|CSOR_BACSU|3e-13|37.3|75/101| BL:PDB:NREP 1 BL:PDB:REP 10->62|2hh7A|5e-08|35.8|53/85| RP:PFM:NREP 1 RP:PFM:REP 7->88|PF02583|8e-13|45.6|79/84|DUF156| HM:PFM:NREP 1 HM:PFM:REP 6->89|PF02583|8.4e-28|43.9|82/85|DUF156| OP:NHOMO 261 OP:NHOMOORG 229 OP:PATTERN -------------------------------------------------------------------- ----11-111111111211-14111111111122431222-111111-111-211111--11311111111----1111111--1-----------------------1----------------------------1111---11------------------------------------------11-211111111211112111111111111212111111111121-111-1111111111111111-----------------------------------------------------------------------2111111111111-111-1111--111111-3211-11211111----1--1--1-------11221111111----------1-11--1-1-----------------11-21---------------------1----------------------------------1------------------------------------------------------------11---------1---11-------------1-1---1-121-1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------111111111-------------------------------------11----------1----------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 58.9 SQ:SECSTR #########HHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT############################ DISOP:02AL 90-91| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc //