[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31035.1
DDBJ      :             ubiquinone biosynthesis protein
Swiss-Prot:COQ7_FRATW   RecName: Full=2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase;         EC=1.14.13.-;AltName: Full=5-demethoxyubiquinone hydroxylase;         Short=DMQ hydroxylase;

Homologs  Archaea  0/68 : Bacteria  138/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:211 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   77->204 2c2jA PDBj 2e-16 10.9 %
:RPS:SCOP  40->178 1uvhA1  a.25.1.1 * 6e-16 11.5 %
:HMM:SCOP  41->187 1nfvA_ a.25.1.1 * 9.5e-17 26.3 %
:RPS:PFM   52->210 PF03232 * COQ7 3e-34 44.7 %
:HMM:PFM   52->203 PF03232 * COQ7 2.3e-22 25.7 152/172  
:BLT:SWISS 1->211 COQ7_FRATW e-121 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31035.1 GT:GENE ACD31035.1 GT:PRODUCT ubiquinone biosynthesis protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1228163..1228798) GB:FROM 1228163 GB:TO 1228798 GB:DIRECTION - GB:PRODUCT ubiquinone biosynthesis protein GB:PROTEIN_ID ACD31035.1 GB:DB_XREF GI:187712738 LENGTH 211 SQ:AASEQ MRKLSFLDRVIEELDSYARFTKVPLNPSKKSPSSDTIDGKLSEIEKKHSAGLMRVDYTGEICAQGLYRGQASVAKSPQTKEHLYHAAAEEYDHLAWCGERLQELGARPSLLNPFWYWTSFGIGAVAGSISDSLSYGFVVETEKQVMKHLDSHLKSLPVNDNRSREILKQMYIDESEHAVEAEKAGGKKLPKTVKAIMKLQSKVMTTLAYRF GT:EXON 1|1-211:0| SW:ID COQ7_FRATW SW:DE RecName: Full=2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; EC=1.14.13.-;AltName: Full=5-demethoxyubiquinone hydroxylase; Short=DMQ hydroxylase; SW:GN Name=coq7; OrderedLocusNames=FTW_1005; SW:KW Cell membrane; Complete proteome; Iron; Membrane; Metal-binding;Monooxygenase; Oxidoreductase; Ubiquinone biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->211|COQ7_FRATW|e-121|100.0|211/211| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004497|"GO:monooxygenase activity"|Monooxygenase| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006744|"GO:ubiquinone biosynthetic process"|Ubiquinone biosynthesis| RP:PDB:NREP 1 RP:PDB:REP 77->204|2c2jA|2e-16|10.9|128/165| RP:PFM:NREP 1 RP:PFM:REP 52->210|PF03232|3e-34|44.7|159/167|COQ7| HM:PFM:NREP 1 HM:PFM:REP 52->203|PF03232|2.3e-22|25.7|152/172|COQ7| RP:SCP:NREP 1 RP:SCP:REP 40->178|1uvhA1|6e-16|11.5|139/157|a.25.1.1| HM:SCP:REP 41->187|1nfvA_|9.5e-17|26.3|137/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 170 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-----------11------------------------111111111111111111111111111111111111111111111111111111-1111-------111111---------------------------------------------------------11-----1---------------------------1--1--------------------------------------------------------------------------------------------1111111111-1-11---------------11111111111111111111111111111111111111---------------11111111111111----------------------------------------------------------- ----11------111------------------------------------------------11-------1-1------1111--------1--111-----------232111-------------------------------------------111---1----1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 83.9 SQ:SECSTR ###########################cTTTcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHTccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHGGGcccTTcccccGGGTTTccc####### PSIPRED ccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHc //