[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31051.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:249 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->130 PF10110 * GPDPase_memb 0.00071 20.2 84/149  
:BLT:SWISS 72->180 UPPP_WIGBR 7e-04 29.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31051.1 GT:GENE ACD31051.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1254442..1255191) GB:FROM 1254442 GB:TO 1255191 GB:DIRECTION - GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD31051.1 GB:DB_XREF GI:187712754 LENGTH 249 SQ:AASEQ MSNLNFKGTISLAATIYKRAFKITFALAFMLSFISEFCFVYLMNHGMDKFIQSNGEADVSQLPSGNILAAMFLIIMVATIFVYAMIIILQGIMIKHELKVSDALKIALQIFSKRVFAFLRAFLLSMIAMTLLTMFLQYIGIFLAILLFLTVMPAVLLAQKGVFESLSANFYAVKNNFFYMFRISITILAFMIIKPLLTFGLIYLLKDLGVEIGSLEMSIQNIVVTVVDAFILPFIFAISVAAFFSTSSK GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 72->180|UPPP_WIGBR|7e-04|29.7|101/100| TM:NTM 6 TM:REGION 22->44| TM:REGION 69->91| TM:REGION 106->128| TM:REGION 139->161| TM:REGION 182->204| TM:REGION 222->244| SEG 234->248|fifaisvaaffstss| HM:PFM:NREP 1 HM:PFM:REP 40->130|PF10110|0.00071|20.2|84/149|GPDPase_memb| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,59-59,62-62,87-87,90-90,95-95,157-157,160-160| PSIPRED ccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //