[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31068.1
DDBJ      :             isochorismatase family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:167 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   5->154 3eefA PDBj 2e-12 14.2 %
:RPS:SCOP  5->166 1nf8A  c.33.1.3 * 2e-14 16.4 %
:HMM:SCOP  1->167 1x9gA_ c.33.1.3 * 4.5e-20 23.8 %
:RPS:PFM   105->152 PF00857 * Isochorismatase 8e-04 34.0 %
:HMM:PFM   4->153 PF00857 * Isochorismatase 1.9e-21 23.5 149/174  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31068.1 GT:GENE ACD31068.1 GT:PRODUCT isochorismatase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1277261..1277764) GB:FROM 1277261 GB:TO 1277764 GB:DIRECTION - GB:PRODUCT isochorismatase family protein GB:PROTEIN_ID ACD31068.1 GB:DB_XREF GI:187712771 LENGTH 167 SQ:AASEQ MSKLLVVINMQKGFDCSEARAVIPNLNKFYTYFDNVSFVMFENRKNSLFETQLKWIDFQNEEDRKLIEGVEIPQNAHFTHHHNYTVYNDELKALIKKLKPAKVYLSGLFSDVCLLKTAMDMFDDGIVPYIIKDISGSPHGDIAHEVAFAAMKEGLGADRIISTKEIS GT:EXON 1|1-167:0| SEG 91->102|lkalikklkpak| RP:PDB:NREP 1 RP:PDB:REP 5->154|3eefA|2e-12|14.2|148/168| RP:PFM:NREP 1 RP:PFM:REP 105->152|PF00857|8e-04|34.0|47/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 4->153|PF00857|1.9e-21|23.5|149/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 5->166|1nf8A|2e-14|16.4|159/207|c.33.1.3| HM:SCP:REP 1->167|1x9gA_|4.5e-20|23.8|147/192|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 19 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22223222---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 89.2 SQ:SECSTR ####EEEEccHHHHTccHHHHHHHHHHHHHHTTccEEEEEEcccTTcTTEHHHHccccTTcGGGcccGGGcccTTcEEEEEccccTTTTccHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTTcEEEEEEEEEEccccT#THHHHHHHHHcc############# PSIPRED ccEEEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHccccccccccHHHHHHHHccccccEEEEccccccccccHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHHHcccccEEHHHcc //