[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31071.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->266 3cjpA PDBj 9e-08 13.3 %
:RPS:SCOP  4->266 2ffiA1  c.1.9.15 * 3e-10 13.8 %
:HMM:SCOP  1->266 2ffiA1 c.1.9.15 * 6e-14 20.8 %
:HMM:PFM   4->267 PF04909 * Amidohydro_2 5.5e-13 15.9 246/270  
:BLT:SWISS 3->231 Y4MH_RHISN 2e-10 28.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31071.1 GT:GENE ACD31071.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1280401..1281213) GB:FROM 1280401 GB:TO 1281213 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACD31071.1 GB:DB_XREF GI:187712774 LENGTH 270 SQ:AASEQ MNIVDSHIHFWDITNGYNDWVKDTNLPKLVTPENLEASAFVHIEAHSEKFDPLCEYNWLKSKFNNSNIKVVAFVDFTLEISQFEKKIIYLSEHNNIVGIRQIMSKTYKSKYSPFEKCIPKDLEQKLKILREHKLIFEAQMYPEQFLPLLEKINNSGVKMVVEHFGLPLFGRNNNLAEWQRFIKECSQNTNWNLKLSSFDLNNQMSNVKKALDFVFENISFHQLCYGSNFPVSNHDDYNFWQKFLYKYIDNDEISKHVFKNVARRIYFKEG GT:EXON 1|1-270:0| BL:SWS:NREP 1 BL:SWS:REP 3->231|Y4MH_RHISN|2e-10|28.3|219/297| RP:PDB:NREP 1 RP:PDB:REP 3->266|3cjpA|9e-08|13.3|240/262| HM:PFM:NREP 1 HM:PFM:REP 4->267|PF04909|5.5e-13|15.9|246/270|Amidohydro_2| RP:SCP:NREP 1 RP:SCP:REP 4->266|2ffiA1|3e-10|13.8|247/271|c.1.9.15| HM:SCP:REP 1->266|2ffiA1|6e-14|20.8|250/0|c.1.9.15|1/1|Metallo-dependent hydrolases| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------11-11--------1--------1-------------------------------------------------------------------------------11--------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 91.9 SQ:SECSTR ##cEEEEEEccccHHHHHHHHHHHTccEEEEEccHHHHHTTccTTcHHHHHHHHHHHHHHHHHcTTTEEEEEcccTTccHHHHHHHHHHHTTTTTccEEEEEcccTTcGGG##GHHHHHHHHHTTcccEEEcccTTccHHHHHHHHHHHHHHTcTTccEEEGGGGGGTTTTcTGHHHHHHHHHHc#####TTEEEEcTTcccH######HHHHHHHHHcTTTEEccccTTcccHHH##HHHHHHHHcccHHHHHHHHTHH#HHHHH#### DISOP:02AL 270-271| PSIPRED ccEEEEEEEEEccccccccccccccccccccHHHcEEEEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHcccEEEEcccccccccccccccHHcccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEccHHcccccccHHHHHHHHHHccccHHEEEcccccccccccHHHHHHHHHHHcccHHHHHHHHccccEEEEcccc //