[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ACD31073.1
DDBJ      :             hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:HMM:PFM   22->190 PF00033 * Cytochrom_B_N 1.1e-11 17.5 166/188  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31073.1 GT:GENE ACD31073.1 GT:PRODUCT hypothetical membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1282187..1282774) GB:FROM 1282187 GB:TO 1282774 GB:DIRECTION - GB:PRODUCT hypothetical membrane protein GB:PROTEIN_ID ACD31073.1 GB:DB_XREF GI:187712776 LENGTH 195 SQ:AASEQ MRFFKKLYFFLESFWKYLGKSQDKNFRLIHISLAILVIVQILDSDYVHTRYGLSVGAYLHICVGMTIAILSIIMIIAALEKRGLRYYYPYLFNDYTALKSDLSELTRLRLPNPRSGSIAAIVQGFGLLALSIAWISGSMWFIAWNFQFDYTQNLKDLHKTLVGLIEFYICVRGIMGIVHYFVQRYFRRFISNVDN GT:EXON 1|1-195:0| TM:NTM 4 TM:REGION 26->48| TM:REGION 55->77| TM:REGION 117->139| TM:REGION 159->181| SEG 67->79|iailsiimiiaal| HM:PFM:NREP 1 HM:PFM:REP 22->190|PF00033|1.1e-11|17.5|166/188|Cytochrom_B_N| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1------------------------------------------------------------1------------------------------------1---------------------------------2----------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //